IBAN

From Rosetta Code
Task
IBAN
You are encouraged to solve this task according to the task description, using any language you may know.
This page uses content from Wikipedia. The original article was at IBAN. The list of authors can be seen in the page history. As with Rosetta Code, the text of Wikipedia is available under the GNU FDL. (See links for details on variance)


The   International Bank Account Number (IBAN)   is an internationally agreed means of identifying bank accounts across national borders with a reduced risk of propagating transcription errors.

The IBAN consists of up to 34 alphanumeric characters:

  •   first the two-letter ISO 3166-1 alpha-2 country code,
  •   then two check digits, and
  •   finally a country-specific Basic Bank Account Number (BBAN).


The check digits enable a sanity check of the bank account number to confirm its integrity even before submitting a transaction.


Task

Validate the following fictitious IBAN:   GB82 WEST 1234 5698 7654 32


Details of the algorithm can be found on the Wikipedia page.

Ada

<lang Ada>package Iban_Code is

  function Is_Legal(Iban : String) return Boolean;

end Iban_Code;</lang><lang Ada>with Ada.Characters.Handling; use Ada.Characters.Handling; with Ada.Containers.Hashed_Maps; with Ada.Strings.Hash;

package body Iban_Code is

  subtype Nation is String (1..2);
  
  package String_Integer is new Ada.Containers.Hashed_Maps
    (Nation, Integer, Ada.Strings.Hash, Equivalent_Keys => "=");
  
  Nations : String_Integer.Map;
  
  function Is_Legal(Iban : String) return Boolean
  is
     Temp  : String(Iban'Range) := (others => ' ');
     Count : Integer;
     Ch    : Character;
     Num   : Integer := 0;  
  begin
     -- remove blank spaces and check characters 
     Count := Temp'First;
     for I in Iban'Range loop

case Iban(I) is when ' ' => null; when 'a'..'z' => Temp(Count) := To_Upper(Iban(I)); Count := Count + 1; when 'A'..'Z'|'0'..'9' => Temp(Count) := Iban(I); Count := Count + 1; when others => return False; end case;

     end loop;
     -- check nation code and length
     if not Nations.Contains (Temp(1..2)) or else 

Nations.Element (Temp(1..2))/= Count - 1 then return False;

     end if;
     -- move the 4 initial characters to the end
     Temp(Temp'First..Count-1) := Temp(5..Count-1) & Temp(Temp'First..4);
     -- compute remainder modulo 97
     for I in Temp'First..Count-1 loop

Ch := Temp(I); if Ch in '0'..'9' then Num := Integer'Value(Integer'Image(Num) & Ch) mod 97; else Num := (Num * 100 + (Character'Pos(Ch) - Character'Pos('A') + 10)) mod 97; end if;

     end loop;
     return Num = 1;
  end Is_Legal;
  

begin

  Nations.insert("AL", 28);     Nations.insert("AD", 24);
  Nations.insert("AT", 20);     Nations.insert("AZ", 28);
  Nations.insert("BE", 16);     Nations.insert("BH", 22);
  Nations.insert("BA", 20);     Nations.insert("BR", 29);
  Nations.insert("BG", 22);     Nations.insert("CR", 21);
  Nations.insert("HR", 21);     Nations.insert("CY", 28);
  Nations.insert("CZ", 24);     Nations.insert("DK", 18);
  Nations.insert("DO", 28);     Nations.insert("EE", 20);
  Nations.insert("FO", 18);     Nations.insert("FI", 18);
  Nations.insert("FR", 27);     Nations.insert("GE", 22);
  Nations.insert("DE", 22);     Nations.insert("GI", 23);
  Nations.insert("GR", 27);     Nations.insert("GL", 18);
  Nations.insert("GT", 28);     Nations.insert("HU", 28);
  Nations.insert("IS", 26);     Nations.insert("IE", 22);
  Nations.insert("IL", 23);     Nations.insert("IT", 27);
  Nations.insert("KZ", 20);     Nations.insert("KW", 30);
  Nations.insert("LV", 21);     Nations.insert("LB", 28);
  Nations.insert("LI", 21);     Nations.insert("LT", 20);
  Nations.insert("LU", 20);     Nations.insert("MK", 19);
  Nations.insert("MT", 31);     Nations.insert("MR", 27);
  Nations.insert("MU", 30);     Nations.insert("MC", 27);
  Nations.insert("MD", 24);     Nations.insert("ME", 22);
  Nations.insert("NL", 18);     Nations.insert("NO", 15);
  Nations.insert("PK", 24);     Nations.insert("PS", 29);
  Nations.insert("PL", 28);     Nations.insert("PT", 25);
  Nations.insert("RO", 24);     Nations.insert("SM", 27);
  Nations.insert("SA", 24);     Nations.insert("RS", 22);
  Nations.insert("SK", 24);     Nations.insert("SI", 19);
  Nations.insert("ES", 24);     Nations.insert("SE", 24);
  Nations.insert("CH", 21);     Nations.insert("TN", 24);
  Nations.insert("TR", 26);     Nations.insert("AE", 23);
  Nations.insert("GB", 22);     Nations.insert("VG", 24);

end Iban_Code;</lang>Testing: <lang Ada>with Ada.Text_Io; use Ada.Text_Io; with Iban_Code;

procedure Check_Iban is

  procedure Check(Iban : String) is   
  begin
     if Iban_Code.Is_Legal(Iban) then

Put_Line(Iban & " is valid.");

     else

Put_Line(Iban & " is not valid.");

     end if;
  end Check;
  

begin

  Check("GB82 WEST 1234 5698 7654 32");
  Check("GB82WEST12345698765432");
  Check("gb82 west 1234 5698 7654 32");
  Check("GB82 TEST 1234 5698 7654 32");
  Check("GB82 WEST 1243 5698 7654 32");

end Check_Iban;</lang>

Output:
GB82 WEST 1234 5698 7654 32 is valid.
GB82WEST12345698765432 is valid.
gb82 west 1234 5698 7654 32 is valid.
GB82 TEST 1234 5698 7654 32 is not valid.
GB82 WEST 1243 5698 7654 32 is not valid.

AutoHotkey

Works with: AutoHotkey 1.1

<lang AutoHotkey>IBANs := ["GB82 WEST 1234 5698 7654 32" , "gb82 WEST 1234 5698 7654 32" , "GB82WEST12345698765432" , "GB82 WEST 234 5698 7654 32" , "GB82 WEST 1234 5698 7654 33" , "AE82 WEST 1234 5698 7654 32"] for k, v in IBANs Output .= v " is" (ValidIBAN(v) ? "" : " not") " valid.`n" MsgBox, % Output

ValidIBAN(n) { static CC := {AL:28, AD:24, AT:20, AZ:28, BH:22, BE:16, BA:20, BR:29, BG:22, CR:21 , HR:21, CY:28, CZ:24, DK:18, DO:28, EE:20, FO:18, FI:18, FR:27, GE:22 , DE:22, GI:23, GR:27, GL:18, GT:28, HU:28, IS:26, IE:22, IL:23, IT:27 , JO:30, KZ:20, KW:30, LV:21, LB:28, LI:21, LT:20, LU:20, MK:19, MT:31 , MR:27, MU:30, MC:27, MD:24, ME:22, NL:18, NO:15, PK:24, PS:29, PL:28 , PT:25, QA:29, RO:24, SM:27, SA:24, RS:22, SK:24, SI:19, ES:24, SE:24 , CH:21, TN:24, TR:26, AE:23, GB:22, VG:24} StringReplace, n, n, % A_Space,, A ;Check that the total IBAN length is correct as per the country if (StrLen(n) != CC[SubStr(n, 1, 2)]) return false StringUpper, n, n ;Move the four initial characters to the end of the string n := SubStr(n, 5) SubStr(n, 1, 4) ;Replace each letter in the string with two digits Loop, Parse, n { if A_LoopField is alpha nn .= Asc(A_LoopField) - 55 else nn .= A_LoopField } return Mod97(nn) = 1 }

Mod97(a) { while a { rem := Mod(rem SubStr(a, 1, 15), 97) a := SubStr(a, 16) } return rem

}</lang>

Output:
GB82 WEST 1234 5698 7654 32 is valid.
gb82 WEST 1234 5698 7654 32 is valid.
GB82WEST12345698765432 is valid.
GB82 WEST 234 5698 7654 32 is not valid.
GB82 WEST 1234 5698 7654 33 is not valid.
AE82 WEST 1234 5698 7654 32 is not valid.

AWK

Works with: gawk

This requires a gawk with extensions and GNU MP+MPFR support - it's usually the case. Some country codes are missing, the output is itself parsable.

<lang awk> @load "ordchr"

function invalid() { print("INVALID " $0); next } function valid() { print("VALID__ " $0) }

BEGIN {

   ccibanlen["AL"] = 28; ccibanlen["AD"] = 24; ccibanlen["AT"] = 20; 
   ccibanlen["AZ"] = 28; ccibanlen["BH"] = 22; ccibanlen["BA"] = 20; 
   ccibanlen["BR"] = 29; ccibanlen["BG"] = 22; ccibanlen["CR"] = 21; 
   ccibanlen["HR"] = 21; ccibanlen["CY"] = 28; ccibanlen["CZ"] = 24; 
   ccibanlen["DK"] = 18; ccibanlen["DO"] = 28; ccibanlen["EE"] = 20; 
   ccibanlen["FO"] = 18; ccibanlen["FI"] = 18; ccibanlen["FR"] = 27; 
   ccibanlen["GE"] = 22; ccibanlen["DE"] = 22; ccibanlen["GI"] = 23; 
   ccibanlen["GR"] = 27; ccibanlen["GL"] = 18; ccibanlen["GT"] = 28; 
   ccibanlen["HU"] = 28; ccibanlen["IS"] = 26; ccibanlen["IE"] = 22; 
   ccibanlen["IT"] = 27; ccibanlen["KZ"] = 20; ccibanlen["KW"] = 30; 
   ccibanlen["LV"] = 21; ccibanlen["LB"] = 28; ccibanlen["LI"] = 21; 
   ccibanlen["LT"] = 20; ccibanlen["LU"] = 20; ccibanlen["MK"] = 19; 
   ccibanlen["MT"] = 31; ccibanlen["MR"] = 27; ccibanlen["MU"] = 30; 
   ccibanlen["MC"] = 27; ccibanlen["MD"] = 24; ccibanlen["ME"] = 22; 
   ccibanlen["NL"] = 18; ccibanlen["NO"] = 15; ccibanlen["PK"] = 24; 
   ccibanlen["PS"] = 29; ccibanlen["PL"] = 28; ccibanlen["PT"] = 25; 
   ccibanlen["RO"] = 24; ccibanlen["SM"] = 27; ccibanlen["SA"] = 24; 
   ccibanlen["RS"] = 22; ccibanlen["SK"] = 24; ccibanlen["SI"] = 19; 
   ccibanlen["ES"] = 24; ccibanlen["SE"] = 24; ccibanlen["CH"] = 21; 
   ccibanlen["TN"] = 24; ccibanlen["TR"] = 26; ccibanlen["AE"] = 23; 
   ccibanlen["GB"] = 22; ccibanlen["VG"] = 24; ccibanlen["BE"] = 16;  

}

{

   iban = toupper($0)
   gsub(/\s+/, "", iban)
   ccode = substr(iban, 1, 2)
   
   if (    ! match(iban, /^[A-Z0-9]+$/) ||     
           ! (ccode in ccibanlen) ||           
           length(iban) != ccibanlen[ccode])   
       invalid()
   
   ibanrev = gensub(/^(.{4})(.+)/, "\\2\\1", 1, iban)
   ibancsum = ""
   for (i = 1; i <= length(ibanrev); i++) {
       currchar = substr(ibanrev, i, 1)
       if (match(currchar, /[A-Z]/)) 
           currchar = ord(currchar) - 55
       ibancsum = ibancsum currchar
   }
   
   ibancsum % 97 == 1 ? valid() : invalid()

}</lang> Creating a test file and launching the script: <lang> cat > test.iban FR33 ^__^ 0BAD AA11 1234 6543 1212 FR33 1234 5432 CH93 0076 2011 6238 5295 7 GB82 WEST 1234 5698 7654 32 GB82 TEST 1234 5698 7654 32 ^D gawk -Mf iban.gawk test.iban </lang>

Output:

<lang> INVALID FR33 ^__^ 0BAD INVALID AA11 1234 6543 1212 INVALID FR33 1234 5432 VALID__ CH93 0076 2011 6238 5295 7 VALID__ GB82 WEST 1234 5698 7654 32 INVALID GB82 TEST 1234 5698 7654 32 </lang>

BBC BASIC

<lang bbcbasic> REM Used the following as official standard:

     REM  http://www.cnb.cz/cs/platebni_styk/iban/download/EBS204.pdf
     REM Pairs of ISO 3166 country code & expected IBAN length for this country
     COULEN$="AL28 AD24 AT20 AZ28 BE16 BH22 BA20 BR29 BG22 CR21 HR21 CY28 CZ24 DK18 DO28 EE20 "+\
     \       "FO18 FI18 FR27 GE22 DE22 GI23 GR27 GL18 GT28 HU28 IS26 IE22 IL23 IT27 KZ20 KW30 "+\
     \       "LV21 LB28 LI21 LT20 LU20 MK19 MT31 MR27 MU30 MC27 MD24 ME22 NL18 NO15 PK24 PS29 "+\
     \       "PL28 PT25 RO24 SM27 SA24 RS22 SK24 SI19 ES24 SE24 CH21 TN24 TR26 AE23 GB22 VG24"
     PROCIBANcheck("GB82 WEST 1234 5698 7654 32"):REM Paper IBAN notation (with the spaces)
     PROCIBANcheck("GB82WEST12345698765432")     :REM Digital IBAN notation (without the spaces)
     PROCIBANcheck("gb82 west 1234 5698 7654 32")
     PROCIBANcheck("GB82 TEST 1234 5698 7654 32")
     PROCIBANcheck("GR16 0110 1250 0000 0001 2300 695")
     PROCIBANcheck("GB29 NWBK 6016 1331 9268 19")
     PROCIBANcheck("SA03 8000 0000 6080 1016 7519")
     PROCIBANcheck("CH93 0076 2011 6238 5295 7")
     PROCIBANcheck("IL62 0108 0000 0009 9999 999")
     PROCIBANcheck("IL62-0108-0000-0009-9999-999")
     PROCIBANcheck("US12 3456 7890 0987 6543 210")
     PROCIBANcheck("GR16 0110 1250 0000 0001 2300 695X")
     END
     DEF PROCIBANcheck(iban$)
     LOCAL err$,i%,match%,explen%,digiban$,tmpiban$,bignum$,c%,kk%
     REM Search for country code and fetch expected length
     i%=1:explen%=0
     WHILE explen%=0 AND i%<LENCOULEN$
       IF LEFT$(iban$,2)=MID$(COULEN$,i%,2) explen%=VALMID$(COULEN$,i%+2,2)
       i%+=5
     ENDWHILE
     match%=explen%>0
     REM Continue if country code found
     IF match% THEN
       REM Remove space = convert to digital IBAN
       digiban$=""
       FOR i%=1TOLENiban$
         IF MID$(iban$,i%,1)>" " digiban$+=MID$(iban$,i%,1)
       NEXT
       REM Compare length with expected length
       match%=explen%=LENdigiban$
 
       REM Continue if length is correct
       IF match% THEN
         REM Create temporary string with country code appended
         tmpiban$=MID$(digiban$,5)+MID$(digiban$,1,2)
         REM Make big number, replacing letters by numbers using next conversion table: A=10 ... Z=35
         bignum$=""
         FOR i%=1TOLENtmpiban$
           c%=ASCMID$(tmpiban$,i%,1)
           IF c%>57 bignum$+=STR$(c%-55) ELSE bignum$+=STR$(c%-48)
         NEXT
         REM MOD 97 on bignum$+"00" and subtract result from 98 to obtain control number
         kk%=98-FNmod97(bignum$+"00")
         REM Compare with control number in IBAN
         match%=VALMID$(iban$,3,2)=kk%
   
         REM Continue if control number matches
         IF match% THEN
           REM Append kk% to bignum$ and determine if MOD 97 results in 1
           match%=FNmod97(bignum$+RIGHT$("0"+STR$kk%,2))=1
     
           REM Continue if MOD 97
           IF match% THEN
             REM Was last test
           ELSE
             err$="result from modulo 97"
           ENDIF
         ELSE
           err$="check digits, should be: "+STR$kk%
         ENDIF
       ELSE
         err$="code length, expected length: "+STR$explen%
       ENDIF
     ELSE
       err$="country code: "+LEFT$(iban$,2)
     ENDIF
     IF match% PRINT "  "; ELSE PRINT "in";:err$="***error!*** invalid "+err$
     PRINT "valid IBAN: ";iban$TAB(50)err$
     ENDPROC
     DEF FNmod97(num$)
     LOCAL mod$
     mod$=LEFT$(num$,2)
     num$=MID$(num$,3)
     WHILE num$>""
       mod$=RIGHT$("0"+STR$(VAL(mod$+LEFT$(num$,7))MOD97),2)
       num$=MID$(num$,8)
     ENDWHILE

=VALmod$</lang>

Output:
  valid IBAN: GB82 WEST 1234 5698 7654 32
  valid IBAN: GB82WEST12345698765432
invalid IBAN: gb82 west 1234 5698 7654 32         ***error!*** invalid country code: gb
invalid IBAN: GB82 TEST 1234 5698 7654 32         ***error!*** invalid check digits, should be: 78
  valid IBAN: GR16 0110 1250 0000 0001 2300 695
  valid IBAN: GB29 NWBK 6016 1331 9268 19
  valid IBAN: SA03 8000 0000 6080 1016 7519
  valid IBAN: CH93 0076 2011 6238 5295 7
  valid IBAN: IL62 0108 0000 0009 9999 999
invalid IBAN: IL62-0108-0000-0009-9999-999        ***error!*** invalid code length, expected length: 23
invalid IBAN: US12 3456 7890 0987 6543 210        ***error!*** invalid country code: US
invalid IBAN: GR16 0110 1250 0000 0001 2300 695X  ***error!*** invalid code length, expected length: 27

Befunge

<lang befunge>>>" :NABI">:#,_>:~:"`"`48**-:55+-#v_$0::6g0>>8g-!\7g18g-!*!v>v>> <<_#v:#78#`8#+<^+!!*-*84\-9:g8:p8\<oo>1#$-#<0$>>>#v_"dilav" ^#<< >>^ >*-:20p9`9*1+55+**20g+"a"%10g1+00g%:4-!|^g6::_v#-*88:+1_vv>> <<^+`"Z"\+`\"0"\*`\"A"\`"9":::\-*86:g8p01:<<40p00_v#!--+99g5<v<< >>" si rebmun tahT">:#,_ 55+".",,@ >0"dilavni">>> "-(&(/$$*$(*.-*.('$)*%0-&**.$'(.'/.+,&&*.)**&,-.&.(*(*-!(%01-) BFBBBBFFTNRRGGCCGCGGSSKSKSSDDHDHCPLPTLLLLPPAAVEIIAAAIEMMMNGMMMMI ERGAHRIONLSOTRZYBRLIKIWMZAEOKREUHSBTRIVTUKLEDGESTLTZESEDCOEKUTRL</lang>

Output:
IBAN: GB82 WEST 1234 5698 7654 32
That number is valid.
IBAN: GB82 EAST 1234 5698 7654 32
That number is invalid.

Bracmat

<lang bracmat>( ( IBAN-check

 =   table country cd len N c
   .       (AL.28) (AD.24) (AT.20) (AZ.28) (BE.16) (BH.22) (BA.20) (BR.29)
           (BG.22) (CR.21) (HR.21) (CY.28) (CZ.24) (DK.18) (DO.28) (EE.20)
           (FO.18) (FI.18) (FR.27) (GE.22) (DE.22) (GI.23) (GR.27) (GL.18)
           (GT.28) (HU.28) (IS.26) (IE.22) (IL.23) (IT.27) (KZ.20) (KW.30)
           (LV.21) (LB.28) (LI.21) (LT.20) (LU.20) (MK.19) (MT.31) (MR.27)
           (MU.30) (MC.27) (MD.24) (ME.22) (NL.18) (NO.15) (PK.24) (PS.29)
           (PL.28) (PT.25) (RO.24) (SM.27) (SA.24) (RS.22) (SK.24) (SI.19)
           (ES.24) (SE.24) (CH.21) (TN.24) (TR.26) (AE.23) (GB.22) (VG.24)
       : ?table
     & @(!arg:?country [2 ?cd [4 ?arg)
     & str$(!arg !country !cd):?arg
     & (   !table:? (!country.?len) ?
         & :?N
         & ( @( !arg
              :   ?
                  ( %@?c ?
                  & ( !c:#
                    |   !c:~<A:~>Z
                      & asc$!c+-1*asc$A+10:?c
                      & 1+!len:?len
                    | !c:" "&:?c
                    | 
                    )
                  & !N !c:?N
                  & ~
                  )
              )
           |   str$!N:?N:#
             & (   @(!N:? [!len)
                 & ( mod$(!N,97):1&out$OK
                   | out$"wrong check digits"
                   )
               | out$"wrong length"
               )
           |   @(!N:? ~#%?c ?)
             & out$(str$("invalid character: '" !c "'"))
           )
       | out$(str$("invalid country code: '" !country "'"))
       )
 )

& IBAN-check$"GB82 WEST 1234 5698 7654 32 9" & IBAN-check$"GX82 WEST 1234 5698 7654 32" & IBAN-check$"GB82 WEST 1234 5698 7654 32" & IBAN-check$GB82WEST12345698765432 & IBAN-check$"gb82 west 1234 5698 7654 32" & IBAN-check$"GB82 TEST 1234 5698 7654 32" & IBAN-check$"GB82 WEST 1243 5698 7654 32" & IBAN-check$"GB82 west 1243 5698 7654 32"

);</lang>

Output:
wrong length
invalid country code: 'GX'
OK
OK
invalid country code: 'gb'
wrong check digits
wrong check digits
invalid character: 'w'

C

<lang C>#include <alloca.h>

  1. include <ctype.h>
  2. include <stdio.h>
  3. include <stdlib.h>
  4. include <string.h>
  1. define V(cc, exp) if (!strncmp(iban, cc, 2)) return len == exp

/* Validate country code against expected length. */ int valid_cc(const char *iban, int len) {

   V("AL", 28); V("AD", 24); V("AT", 20); V("AZ", 28); V("BE", 16); V("BH", 22); V("BA", 20); V("BR", 29);
   V("BG", 22); V("CR", 21); V("HR", 21); V("CY", 28); V("CZ", 24); V("DK", 18); V("DO", 28); V("EE", 20);
   V("FO", 18); V("FI", 18); V("FR", 27); V("GE", 22); V("DE", 22); V("GI", 23); V("GR", 27); V("GL", 18);
   V("GT", 28); V("HU", 28); V("IS", 26); V("IE", 22); V("IL", 23); V("IT", 27); V("KZ", 20); V("KW", 30);
   V("LV", 21); V("LB", 28); V("LI", 21); V("LT", 20); V("LU", 20); V("MK", 19); V("MT", 31); V("MR", 27);
   V("MU", 30); V("MC", 27); V("MD", 24); V("ME", 22); V("NL", 18); V("NO", 15); V("PK", 24); V("PS", 29);
   V("PL", 28); V("PT", 25); V("RO", 24); V("SM", 27); V("SA", 24); V("RS", 22); V("SK", 24); V("SI", 19);
   V("ES", 24); V("SE", 24); V("CH", 21); V("TN", 24); V("TR", 26); V("AE", 23); V("GB", 22); V("VG", 24);
   return 0;

}

/* Remove blanks from s in-place, return its new length. */ int strip(char *s) {

   int i = -1, m = 0;
   while(s[++i]) {
       s[i - m] = s[i];
       m += s[i] <= 32;
   }
   s[i - m] = 0;
   return i - m;

}

/* Calculate the mod 97 of an arbitrarily large number (as a string). */ int mod97(const char *s, int len) {

   int i, j, parts = len / 7;
   char rem[10] = "00";
   for (i = 1; i <= parts + (len % 7 != 0); ++i) {
       strncpy(rem + 2, s + (i - 1) * 7, 7);
       j = atoi(rem) % 97;
       rem[0] = j / 10 + '0';
       rem[1] = j % 10 + '0';
   }
   return atoi(rem) % 97;

}

int valid_iban(char *iban) {

   int i, j, l = 0, sz = strip(iban);
   char *rot, *trans;
   /* Ensure upper alphanumeric input and count letters. */
   for (i = 0; i < sz; ++i) {
       if (!isdigit(iban[i]) && !isupper(iban[i]))
           return 0;
       l += !!isupper(iban[i]);
   }
   if (!valid_cc(iban, sz))
       return 0;
   /* Move the first four characters to the end. */
   rot = alloca(sz);
   strcpy(rot, iban + 4);
   strncpy(rot + sz - 4, iban, 4);
   /* Allocate space for the transformed IBAN. */
   trans = alloca(sz + l);
   trans[sz + l] = 0;
   /* Convert A to 10, B to 11, etc. */
   for (i = j = 0; i < sz; ++i, ++j) {
       if (isdigit(rot[i]))
           trans[j] = rot[i];
       else {
           trans[j]   = (rot[i] - 55) / 10 + '0';
           trans[++j] = (rot[i] - 55) % 10 + '0';
       }
   }
   return mod97(trans, sz + l) == 1;

}

int main(int _, char **argv) {

   while (--_, *++argv)
       printf("%s is %svalid.\n", *argv, valid_iban(*argv) ? "" : "in");
   return 0;

}</lang>

Output:
iban 'GB82 WEST 1234 5698 7654 32' GB82TEST12345698765432
GB82WEST12345698765432 is valid.
GB82TEST12345698765432 is invalid.

C++

<lang cpp>#include <string>

  1. include <iostream>
  2. include <boost/algorithm/string.hpp>
  3. include <map>
  4. include <algorithm>
  5. include <cctype>

using namespace boost::algorithm ;

bool isValid ( const std::string &ibanstring ) {

  static std::map<std::string, int> countrycodes 
                          { {"AL" , 28} , {"AD" , 24} , {"AT" , 20} , {"AZ" , 28 } ,

{"BE" , 16} , {"BH" , 22} , {"BA" , 20} , {"BR" , 29 } , {"BG" , 22} , {"CR" , 21} , {"HR" , 21} , {"CY" , 28 } , {"CZ" , 24} , {"DK" , 18} , {"DO" , 28} , {"EE" , 20 } , {"FO" , 18} , {"FI" , 18} , {"FR" , 27} , {"GE" , 22 } ,

                          {"DE" , 22} , {"GI" , 23} , {"GR" , 27} , {"GL" , 18 } ,
                          {"GT" , 28} , {"HU" , 28} , {"IS" , 26} , {"IE" , 22 } , 

{"IL" , 23} , {"IT" , 27} , {"KZ" , 20} , {"KW" , 30 } , {"LV" , 21} , {"LB" , 28} , {"LI" , 21} , {"LT" , 20 } , {"LU" , 20} , {"MK" , 19} , {"MT" , 31} , {"MR" , 27 } , {"MU" , 30} , {"MC" , 27} , {"MD" , 24} , {"ME" , 22 } , {"NL" , 18} , {"NO" , 15} , {"PK" , 24} , {"PS" , 29 } , {"PL" , 28} , {"PT" , 25} , {"RO" , 24} , {"SM" , 27 } , {"SA" , 24} , {"RS" , 22} , {"SK" , 24} , {"SI" , 19 } , {"ES" , 24} , {"SE" , 24} , {"CH" , 21} , {"TN" , 24 } , {"TR" , 26} , {"AE" , 23} , {"GB" , 22} , {"VG" , 24 } } ;

  std::string teststring( ibanstring ) ;
  erase_all( teststring , " " ) ; //defined in boost/algorithm/string.hpp
  if ( countrycodes.find( teststring.substr(0 , 2 )) == countrycodes.end( ) ) 
     return false ;
  if ( teststring.length( ) != countrycodes[ teststring.substr( 0 , 2 ) ] ) 
     return false ;
  if (!all(teststring, is_alnum())) 
     return false ;
  to_upper( teststring ) ;
  std::rotate(teststring.begin(), teststring.begin() + 4, teststring.end());
  std::string numberstring ;//will contain the letter substitutions
  for (const auto& c : teststring)
  {
     if (std::isdigit(c)) 

numberstring += c  ;

     if (std::isupper(c)) 

numberstring += std::to_string(static_cast<int>(c) - 55);

  }
  //implements a stepwise check for mod 97 in chunks of 9 at the first time
  // , then in chunks of seven prepended by the last mod 97 operation converted
  //to a string
  int segstart = 0 ;
  int step = 9 ;
  std::string prepended ;
  long number = 0 ;
  while ( segstart  < numberstring.length( ) - step ) {
     number = std::stol( prepended + numberstring.substr( segstart , step ) ) ;
     int remainder = number % 97 ;
     prepended =  std::to_string( remainder ) ;
     if ( remainder < 10 ) 

prepended = "0" + prepended ;

     segstart = segstart + step ;
     step = 7 ;
  }
  number = std::stol( prepended + numberstring.substr( segstart )) ;
  return ( number % 97 == 1 ) ;

}

void SayValidity(const std::string& iban) {

   std::cout << iban << (isValid(iban) ? " is " : " is not ") << "valid\n";

}

int main( ) {

  SayValidity("GB82 WEST 1234 5698 7654 32");
  SayValidity("GB82TEST12345698765432");
  return 0 ;

}</lang>

Output:
GB82 WEST 1234 5698 7654 32 is valid!
GB82TEST12345698765432 is not valid!

C#

<lang csharp> public class IbanValidator : IValidateTypes

   {
       public ValidationResult Validate(string value)
       {
           // Check if value is missing
           if (string.IsNullOrEmpty(value))
               return ValidationResult.ValueMissing;
           if (value.Length < 2)
               return ValidationResult.ValueTooSmall;
           var countryCode = value.Substring(0, 2).ToUpper();
           int lengthForCountryCode;
           var countryCodeKnown = Lengths.TryGetValue(countryCode, out lengthForCountryCode);
           if (!countryCodeKnown)
           {
               return ValidationResult.CountryCodeNotKnown;
           }
           // Check length.
           if (value.Length < lengthForCountryCode)
               return ValidationResult.ValueTooSmall;
           if (value.Length > lengthForCountryCode)
               return ValidationResult.ValueTooBig;
           value = value.ToUpper();
           var newIban = value.Substring(4) + value.Substring(0, 4);
           newIban = Regex.Replace(newIban, @"\D", match => (match.Value[0] - 55).ToString());
           var remainder = BigInteger.Parse(newIban) % 97;
           if (remainder != 1)
               return ValidationResult.ValueFailsModule97Check;
           return ValidationResult.IsValid;
       }
       public enum ValidationResult
       {
           IsValid,
           ValueMissing,
           ValueTooSmall,
           ValueTooBig,
           ValueFailsModule97Check,
           CountryCodeNotKnown
       }
       private static readonly IDictionary<string, int> Lengths = new Dictionary<string, int>
       {
           {"AL", 28},
           {"AD", 24},
           {"AT", 20},
           {"AZ", 28},
           {"BE", 16},
           {"BH", 22},
           {"BA", 20},
           {"BR", 29},
           {"BG", 22},
           {"CR", 21},
           {"HR", 21},
           {"CY", 28},
           {"CZ", 24},
           {"DK", 18},
           {"DO", 28},
           {"EE", 20},
           {"FO", 18},
           {"FI", 18},
           {"FR", 27},
           {"GE", 22},
           {"DE", 22},
           {"GI", 23},
           {"GR", 27},
           {"GL", 18},
           {"GT", 28},
           {"HU", 28},
           {"IS", 26},
           {"IE", 22},
           {"IL", 23},
           {"IT", 27},
           {"KZ", 20},
           {"KW", 30},
           {"LV", 21},
           {"LB", 28},
           {"LI", 21},
           {"LT", 20},
           {"LU", 20},
           {"MK", 19},
           {"MT", 31},
           {"MR", 27},
           {"MU", 30},
           {"MC", 27},
           {"MD", 24},
           {"ME", 22},
           {"NL", 18},
           {"NO", 15},
           {"PK", 24},
           {"PS", 29},
           {"PL", 28},
           {"PT", 25},
           {"RO", 24},
           {"SM", 27},
           {"SA", 24},
           {"RS", 22},
           {"SK", 24},
           {"SI", 19},
           {"ES", 24},
           {"SE", 24},
           {"CH", 21},
           {"TN", 24},
           {"TR", 26},
           {"AE", 23},
           {"GB", 22},
           {"VG", 24}
       };
   }</lang>Demonstrating:

<lang csharp> public class When_the_IbanValidator_is_told_to_Validate

   {
       [Fact]
       public void It_should_return_an_error_when_there_is_no_value_provided()
       {
           // Assert
           const string value = "";
           var validator = new IbanValidator();
           // Act
           var result = validator.Validate(value);
           // Assert
           Assert.Equal(ValidationResult.ValueMissing, result);
       }
       [Fact]
       public void It_should_return_an_error_when_the_value_length_is_to_short()
       {
           // Assert
           const string value = "BE1800165492356";
           var validator = new IbanValidator();
           // Act
           var result = validator.Validate(value);
           // Assert
           Assert.Equal(ValidationResult.ValueTooSmall, result);
       }
       [Fact]
       public void It_should_return_an_error_when_the_value_length_is_to_big()
       {
           // Assert
           const string value = "BE180016549235656";
           var validator = new IbanValidator();
           // Act
           var result = validator.Validate(value);
           // Assert
           Assert.Equal(ValidationResult.ValueTooBig, result);
       }
       [Fact]
       public void It_should_return_an_error_when_the_value_fails_the_module_check()
       {
           // Assert
           const string value = "BE18001654923566";
           var validator = new IbanValidator();
           // Act
           var result = validator.Validate(value);
           // Assert
           Assert.Equal(ValidationResult.ValueFailsModule97Check, result);
       }
       [Fact]
       public void It_should_return_an_error_when_an_unkown_country_prefix_used()
       {
           // Assert
           const string value = "XX82WEST12345698765432";
           var validator = new IbanValidator();
           // Act
           var result = validator.Validate(value);
           // Assert
           Assert.Equal(ValidationResult.CountryCodeNotKnown, result);
       }
       [Fact]
       public void It_should_return_valid_when_a_valid_value_is_provided()
       {
           // Assert
           const string value = "BE18001654923565";
           var validator = new IbanValidator();
           // Act
           var result = validator.Validate(value);
           // Assert
           Assert.Equal(ValidationResult.IsValid, result);
       }
       [Fact]
       public void It_should_return_valid_when_a_valid_foreign_value_is_provided()
       {
           // Assert
           const string value = "GB82WEST12345698765432";
           var validator = new IbanValidator();
           // Act
           var result = validator.Validate(value);
           // Assert
           Assert.Equal(ValidationResult.IsValid, result);
       }
   }</lang>

Caché ObjectScript

<lang cos>Class Utils.Validate [ Abstract ] {

ClassMethod VerifyIBAN(pIBAN As %String = "") As %Boolean { // remove spaces and define parts Set iban=$Translate(pIBAN, " ") Set cc=$Extract(iban, 1, 2) Set cd=$Extract(iban, 3, 4) Set bban=$Extract(iban, 5, *)

// ensure IBAN is correct format If $Match(iban, ..GetIBANPattern(cc))=0 Quit 0

// compare result and return Quit cd=..GetIBANCheckDigit(cc, bban) }

ClassMethod GetIBANCheckDigit(pCC As %String, pBBAN As %String) As %Integer [ Internal, Private ] { Set str=pBBAN_pCC_"00" For i=1:1 { Set chr=$Extract(str, i) If chr="" Quit If chr?1U Set $Extract(str, i)=$ASCII(chr)-55 } Set cd=98-..GetModulus(str, 97) Quit $Select($Length(cd)=2: cd, 1: "0"_cd) }

ClassMethod GetModulus(pNum As %Integer, pDiv As %Integer) As %Integer [ Internal, Private ] { While $Length(pNum)>9 { Set $Extract(pNum, 1, 9)=$Extract(pNum, 1, 9)#pDiv } Quit pNum#pDiv }

ClassMethod GetIBANPattern(pCC As %String = "") As %String [ Internal, Private ] { Quit $Case(pCC, "AL": "^AL\d{10}[0-9A-Z]{16}$", "AD": "^AD\d{10}[0-9A-Z]{12}$", "AT": "^AT\d{18}$", "BH": "^BH\d{2}[A-Z]{4}[0-9A-Z]{14}$", "BE": "^BE\d{14}$", "BA": "^BA\d{18}$", "BG": "^BG\d{2}[A-Z]{4}\d{6}[0-9A-Z]{8}$", "HR": "^HR\d{19}$", "CY": "^CY\d{10}[0-9A-Z]{16}$", "CZ": "^CZ\d{22}$", "DK": "^DK\d{16}$|^FO\d{16}$|^GL\d{16}$", "DO": "^DO\d{2}[0-9A-Z]{4}\d{20}$", "EE": "^EE\d{18}$", "FI": "^FI\d{16}$", "FR": "^FR\d{12}[0-9A-Z]{11}\d{2}$", "GE": "^GE\d{2}[A-Z]{2}\d{16}$", "DE": "^DE\d{20}$", "GI": "^GI\d{2}[A-Z]{4}[0-9A-Z]{15}$", "GR": "^GR\d{9}[0-9A-Z]{16}$", "HU": "^HU\d{26}$", "IS": "^IS\d{24}$", "IE": "^IE\d{2}[A-Z]{4}\d{14}$", "IL": "^IL\d{21}$", "IT": "^IT\d{2}[A-Z]\d{10}[0-9A-Z]{12}$", "KZ": "^[A-Z]{2}\d{5}[0-9A-Z]{13}$", "KW": "^KW\d{2}[A-Z]{4}22!$", "LV": "^LV\d{2}[A-Z]{4}[0-9A-Z]{13}$", "LB": "^LB\d{6}[0-9A-Z]{20}$", "LI": "^LI\d{7}[0-9A-Z]{12}$", "LT": "^LT\d{18}$", "LU": "^LU\d{5}[0-9A-Z]{13}$", "MK": "^MK\d{5}[0-9A-Z]{10}\d{2}$", "MT": "^MT\d{2}[A-Z]{4}\d{5}[0-9A-Z]{18}$", "MR": "^MR13\d{23}$", "MU": "^MU\d{2}[A-Z]{4}\d{19}[A-Z]{3}$", "MC": "^MC\d{12}[0-9A-Z]{11}\d{2}$", "ME": "^ME\d{20}$", "NL": "^NL\d{2}[A-Z]{4}\d{10}$", "NO": "^NO\d{13}$", "PL": "^PL\d{10}[0-9A-Z]{,16}n$", "PT": "^PT\d{23}$", "RO": "^RO\d{2}[A-Z]{4}[0-9A-Z]{16}$", "SM": "^SM\d{2}[A-Z]\d{10}[0-9A-Z]{12}$", "SA": "^SA\d{4}[0-9A-Z]{18}$", "RS": "^RS\d{20}$", "SK": "^SK\d{22}$", "SI": "^SI\d{17}$", "ES": "^ES\d{22}$", "SE": "^SE\d{22}$", "CH": "^CH\d{7}[0-9A-Z]{12}$", "TN": "^TN59\d{20}$", "TR": "^TR\d{7}[0-9A-Z]{17}$", "AE": "^AE\d{21}$", "GB": "^GB\d{2}[A-Z]{4}\d{14}$", : " ") }

}</lang>

Examples:
USER>For  { Read iban Quit:iban=""  Write " => ", ##class(Utils.Validate).VerifyIBAN(iban), ! }
GB82 WEST 1234 5698 7654 32 => 1
GB82 TEST 1234 5698 7654 32 => 0
GR16 0110 1250 0000 0001 2300 695 => 1
GB29 NWBK 6016 1331 9268 19 => 1
SA03 8000 0000 6080 1016 7519 => 1
CH93 0076 2011 6238 5295 7 => 1
IL62 0108 0000 0009 9999 999 => 1

USER>

Clojure

<lang Clojure>(def explen

 {"AL" 28 "AD" 24 "AT" 20 "AZ" 28 "BE" 16 "BH" 22 "BA" 20 "BR" 29
  "BG" 22 "CR" 21 "HR" 21 "CY" 28 "CZ" 24 "DK" 18 "DO" 28 "EE" 20
  "FO" 18 "FI" 18 "FR" 27 "GE" 22 "DE" 22 "GI" 23 "GR" 27 "GL" 18
  "GT" 28 "HU" 28 "IS" 26 "IE" 22 "IL" 23 "IT" 27 "KZ" 20 "KW" 30
  "LV" 21 "LB" 28 "LI" 21 "LT" 20 "LU" 20 "MK" 19 "MT" 31 "MR" 27
  "MU" 30 "MC" 27 "MD" 24 "ME" 22 "NL" 18 "NO" 15 "PK" 24 "PS" 29
  "PL" 28 "PT" 25 "RO" 24 "SM" 27 "SA" 24 "RS" 22 "SK" 24 "SI" 19
  "ES" 24 "SE" 24 "CH" 21 "TN" 24 "TR" 26 "AE" 23 "GB" 22 "VG" 24})

(defn valid-iban? [iban]

 (let [iban (apply str (remove #{\space \tab} iban))]
   (cond
     ; Ensure upper alphanumeric input.
     (not (re-find #"^[\dA-Z]+$" iban)) false
     ; Validate country code against expected length.
     (not= (explen (subs iban 0 2)) (count iban)) false
     :else
     (let [rot   (flatten (apply conj (split-at 4 iban)))
           trans (map #(read-string (str "36r" %)) rot)]
       (= 1 (mod (bigint (apply str trans)) 97))))))

(prn (valid-iban? "GB82 WEST 1234 5698 7654 32")  ; true

    (valid-iban? "GB82 TEST 1234 5698 7654 32")) ; false</lang>

COBOL

Works with: OpenCOBOL

<lang cobol> IDENTIFICATION DIVISION.

      PROGRAM-ID. iban-main.
      DATA DIVISION.
      WORKING-STORAGE SECTION.
      01  iban                    PIC X(50).
      01  iban-flag               PIC X.
          88  is-valid            VALUE "Y", FALSE "N".
      PROCEDURE DIVISION.
      main-line.
          MOVE "GB82 WEST 1234 5698 7654 32" TO iban
          PERFORM display-validity
          MOVE "GB82 TEST 1234 5698 7654 32" TO iban
          PERFORM display-validity
          GOBACK
          .
      display-validity.
          CALL "validate-iban" USING CONTENT iban, REFERENCE iban-flag
          IF is-valid
              DISPLAY FUNCTION TRIM(iban) " is valid."
          ELSE
              DISPLAY FUNCTION TRIM(iban) " is not valid."
          END-IF
          .
      END PROGRAM iban-main.


      IDENTIFICATION DIVISION.
      PROGRAM-ID. validate-iban.
      DATA DIVISION.
      WORKING-STORAGE SECTION.
      01  country-lengths-area    VALUE "AD24AE23AL28AT20AZ28BA20BE16"
          & "BG22BH22BR29CH21CR21CY28CZ24DE22DK18DO28EE20ES24FI18FO18F"
          & "R27GB22GE22GI23GL18GR27GT28HR21HU28IE22IL23IS26IT27KW30KZ"
          & "20LB28LI21LT20LU20LV21MC27MD24ME22MK19MR27MT31MU30NL18NO1"
          & "5PK24PL28PS29PT25RO24RS22SA24SE24SI19SK24SM27TN24TR26VG24"
          .
          03  country-lengths     OCCURS 64 TIMES
                                  INDEXED BY country-lengths-idx.
              05  country-code    PIC XX.
              05  country-len     PIC 99.
      01  offset                  PIC 99.
      01  i                       PIC 99.
      01  len                     PIC 99.
      LINKAGE SECTION.
      01  iban                    PIC X(50).
      01  valid-flag              PIC X.
          88  is-valid            VALUE "Y", FALSE "N".
      PROCEDURE DIVISION USING iban, valid-flag.
          MOVE FUNCTION UPPER-CASE(iban) TO iban
          CALL "remove-spaces" USING iban
          *> Check if country-code and length are correct
          INITIALIZE len
          INSPECT iban TALLYING len FOR CHARACTERS BEFORE SPACE
          SET country-lengths-idx TO 1
          SEARCH country-lengths
              AT END
                  SET is-valid TO FALSE
                  GOBACK
              WHEN country-code (country-lengths-idx) = iban (1:2)
                  IF country-len (country-lengths-idx) NOT = len
                      SET is-valid TO FALSE
                      GOBACK
                  END-IF
          END-SEARCH
          CALL "create-iban-number" USING CONTENT len, REFERENCE iban
          *> Mod 97 number formed.
          IF FUNCTION MOD(iban, 97) = 1
              SET is-valid TO TRUE
          ELSE
              SET is-valid TO FALSE
          END-IF
          .
      IDENTIFICATION DIVISION.
      PROGRAM-ID. remove-spaces.
      DATA DIVISION.
      WORKING-STORAGE SECTION.
      01  i                       PIC 99.
      01  offset                  PIC 99.
      LINKAGE SECTION.
      01  str                     PIC X(50).
      PROCEDURE DIVISION USING str.
          INITIALIZE offset
          PERFORM VARYING i FROM 1 BY 1 UNTIL i > 50
              EVALUATE TRUE
                  WHEN str (i:1) = SPACE
                      ADD 1 TO offset
              
                  WHEN offset NOT = ZERO
                      MOVE str (i:1) TO str (i - offset:1)
              END-EVALUATE
          END-PERFORM
          MOVE SPACES TO str (50 - offset + 1:)
          .
      END PROGRAM remove-spaces.


      IDENTIFICATION DIVISION.
      PROGRAM-ID. create-iban-number.
      DATA DIVISION.
      WORKING-STORAGE SECTION.
      01  first-four              PIC X(4).
      01  iban-num                PIC X(50).
      01  digit-num               PIC 99 VALUE 1.       
      01  i                       PIC 99.
      01  letter-num              PIC 99.
      LINKAGE SECTION.
      01  len                     PIC 99.
      01  iban                    PIC X(50).
      PROCEDURE DIVISION USING len, iban.
          *> Move characters into final positions.
          MOVE iban (1:4) TO first-four
          MOVE iban (5:) TO iban
          MOVE first-four TO iban (len - 3:)
          *> Convert letters to numbers.
          INITIALIZE iban-num, digit-num ALL TO VALUE
          PERFORM VARYING i FROM 1 BY 1
                  UNTIL i > len OR iban (i:1) = SPACE
              IF iban (i:1) IS NUMERIC
                  MOVE iban (i:1) TO iban-num (digit-num:1)
                  ADD 1 TO digit-num
              ELSE
                  COMPUTE letter-num =
                      FUNCTION ORD(iban (i:1)) - FUNCTION ORD("A") + 10
                  MOVE letter-num TO iban-num (digit-num:2)
                  ADD 2 TO digit-num
              END-IF
          END-PERFORM
          MOVE iban-num TO iban
          .
          
      END PROGRAM create-iban-number.

END PROGRAM validate-iban.</lang>

Output:
GB82 WEST 1234 5698 7654 32 is valid.
GB82 TEST 1234 5698 7654 32 is not valid.

Common Lisp

<lang lisp>

List of the IBAN code lengths per country.

(defvar *IBAN-code-length* '((15 . ("NO"))

                            (16 . ("BE")) 
                            (18 . ("DK" "FO" "FI" "GL" "NL"))
                            (19 . ("MK" "SI"))
                            (20 . ("AT" "BA" "EE" "KZ" "LT" "LU"))
                            (21 . ("CR" "HR" "LV" "LI" "CH"))
                            (22 . ("BH" "BG" "GE" "DE" "IE" "ME" "RS" "GB"))
                            (23 . ("GI" "IL" "AE"))
                            (24 . ("AD" "CZ" "MD" "PK" "RO" "SA" "SK" "ES" "SE" "TN" "VG"))
                            (25 . ("PT"))
                            (26 . ("IS" "TR"))
                            (27 . ("FR" "GR" "IT" "MR" "MC" "SM"))
                            (28 . ("AL" "AZ" "CY" "DO" "GT" "HU" "LB" "PL"))
                            (29 . ("BR" "PS"))
                            (30 . ("KW" "MU"))
                            (31 . ("MT"))))
The IBAN-character function verifies whether the number contains the correct characters only. There is
a built in function to verify for alphanumeric characters, but it includes characters beyond ASCII range.

(defun IBAN-characters (iban)

 (flet ((valid-alphanum (ch)
          (or (and (char<= #\A ch)
                   (char>= #\Z ch))
              (and (char<= #\0 ch)
                   (char>= #\9 ch)))))
   (loop for char across iban
         always (valid-alphanum char))))
The function IBAN-length verifies that the length of the number is correct. The code lengths
are retrieved from the table *IBAN-code-lengths*.

(defun IBAN-length (iban)

 (loop :for  (len . country) :in *IBAN-code-length*
       :with iban-country = (subseq iban 0 2)
       :do
   (when (find iban-country country :test #'string=) (return (= len (length iban))))))
The function IBAN-to-integer converts an IBAN code into an integer number.
Note
The conversion follows the rules stated in the wiki page.

(defun IBAN-to-integer (iban)

 (let ((character-base (- (char-code #\A) 10)))
   (parse-integer 
     (format nil "~{~a~}" (map 'list #'(lambda(X) (if (alpha-char-p X) (- (char-code X) character-base) X ))
                                     (concatenate 'string (subseq iban 4) (subseq iban 0 4)))))))
The function IBAN-verify checks that the code contains right character set, has the
country specific length and has the correct check sum.

(defun IBAN-verify (iban)

 (flet ((validp (X) (and (IBAN-characters X)
                         (IBAN-length X)
                         (= 1 (mod (IBAN-to-integer X) 97)))))
   (validp (remove #\Space iban))))

</lang> Output:

* (iban-verify "GB82 WEST 1234 5698 7654 32")

T
* (iban-verify "GB82 TEST 1234 5698 7654 32")

NIL

D

Translation of: Python

<lang d>import std.stdio, std.string, std.regex, std.conv, std.bigint,

      std.algorithm, std.ascii;

immutable int[string] country2len; static this() {

   country2len = ["AL":28, "AD":24, "AT":20, "AZ":28, "BE":16,
   "BH":22, "BA":20, "BR":29, "BG":22, "CR":21, "HR":21, "CY":28,
   "CZ":24, "DK":18, "DO":28, "EE":20, "FO":18, "FI":18, "FR":27,
   "GE":22, "DE":22, "GI":23, "GR":27, "GL":18, "GT":28, "HU":28,
   "IS":26, "IE":22, "IL":23, "IT":27, "KZ":20, "KW":30, "LV":21,
   "LB":28, "LI":21, "LT":20, "LU":20, "MK":19, "MT":31, "MR":27,
   "MU":30, "MC":27, "MD":24, "ME":22, "NL":18, "NO":15, "PK":24,
   "PS":29, "PL":28, "PT":25, "RO":24, "SM":27, "SA":24, "RS":22,
   "SK":24, "SI":19, "ES":24, "SE":24, "CH":21, "TN":24, "TR":26,
   "AE":23, "GB":22, "VG":24];

}

bool validIBAN(string iban) {

   // Ensure upper alphanumeric input.
   iban = iban.removechars(whitespace);
   if (!iban.match(r"^[\dA-Z]+$"))
       return false;
   // Validate country code against expected length.
   if (iban.length != country2len[iban[0 .. 2]])
       return false;
   // Shift and convert. BASE 36: 0..9,A..Z -> 0..35.
   iban = iban[4 .. $] ~ iban[0 .. 4];
   return iban.map!(c => [c].to!int(36).text).join.BigInt % 97 == 1;

}

void main() {

   foreach (account; ["GB82 WEST 1234 5698 7654 32",
                      "GB82 TEST 1234 5698 7654 32"])
       writefln("%s validation is: %s", account, account.validIBAN);

}</lang>

Output:
GB82 WEST 1234 5698 7654 32 validation is: true
GB82 TEST 1234 5698 7654 32 validation is: false

Elixir

Translation of: Ruby

<lang elixir>defmodule IBAN do

 @len %{ AL: 28, AD: 24, AT: 20, AZ: 28, BE: 16, BH: 22, BA: 20, BR: 29,
         BG: 22, CR: 21, HR: 21, CY: 28, CZ: 24, DK: 18, DO: 28, EE: 20,
         FO: 18, FI: 18, FR: 27, GE: 22, DE: 22, GI: 23, GR: 27, GL: 18,
         GT: 28, HU: 28, IS: 26, IE: 22, IL: 23, IT: 27, KZ: 20, KW: 30,
         LV: 21, LB: 28, LI: 21, LT: 20, LU: 20, MK: 19, MT: 31, MR: 27,
         MU: 30, MC: 27, MD: 24, ME: 22, NL: 18, NO: 15, PK: 24, PS: 29,
         PL: 28, PT: 25, RO: 24, SM: 27, SA: 24, RS: 22, SK: 24, SI: 19,
         ES: 24, SE: 24, CH: 21, TN: 24, TR: 26, AE: 23, GB: 22, VG: 24 }
 
 def valid?(iban) do
   iban = String.replace(iban, ~r/\s/, "")
   if Regex.match?(~r/^[\dA-Z]+$/, iban) do
     cc = String.slice(iban, 0..1) |> String.to_atom
     if String.length(iban) == @len[cc] do
       {left, right} = String.split_at(iban, 4)
       num = String.codepoints(right <> left)
             |> Enum.map_join(fn c -> String.to_integer(c,36) end)
             |> String.to_integer
       rem(num,97) == 1
     else
       false
     end
   else
     false
   end
 end

end

[ "GB82 WEST 1234 5698 7654 32",

 "gb82 west 1234 5698 7654 32",
 "GB82 WEST 1234 5698 7654 320",
 "GB82WEST12345698765432",
 "GB82 TEST 1234 5698 7654 32",
 "ZZ12 3456 7890 1234 5678 12"  ]

|> Enum.each(fn iban -> IO.puts "#{IBAN.valid?(iban)}\t#{iban}" end)</lang>

Output:
true    GB82 WEST 1234 5698 7654 32
false   gb82 west 1234 5698 7654 32
false   GB82 WEST 1234 5698 7654 320
true    GB82WEST12345698765432
false   GB82 TEST 1234 5698 7654 32
false   ZZ12 3456 7890 1234 5678 12

F#

<lang fsharp>open System open System.Text.RegularExpressions

// A little utility to thread a negative test result (Option.None) through a // pipeline of tests let inline (|~>) valOption proc =

   match valOption with
   | Some(value) -> proc value
   | None -> None

[<EntryPoint>] let main argv =

   let iban = if argv.Length = 0 then "" else argv.[0]
   iban
   |> (fun iban ->     // Check for illegal characters
           if Regex.IsMatch(iban, @"[^0-9A-Za-z ]") then None else Some(iban.ToUpper().Replace(" ", "")))
   |~> (fun iban ->    // Check length per country code
           let lengthPerCountry =
               dict [
                   ("AL", 28); ("AD", 24); ("AT", 20); ("AZ", 28); ("BE", 16); ("BH", 22); ("BA", 20); ("BR", 29);
                   ("BG", 22); ("CR", 21); ("HR", 21); ("CY", 28); ("CZ", 24); ("DK", 18); ("DO", 28); ("EE", 20);
                   ("FO", 18); ("FI", 18); ("FR", 27); ("GE", 22); ("DE", 22); ("GI", 23); ("GR", 27); ("GL", 18);
                   ("GT", 28); ("HU", 28); ("IS", 26); ("IE", 22); ("IL", 23); ("IT", 27); ("KZ", 20); ("KW", 30);
                   ("LV", 21); ("LB", 28); ("LI", 21); ("LT", 20); ("LU", 20); ("MK", 19); ("MT", 31); ("MR", 27);
                   ("MU", 30); ("MC", 27); ("MD", 24); ("ME", 22); ("NL", 18); ("NO", 15); ("PK", 24); ("PS", 29);
                   ("PL", 28); ("PT", 25); ("RO", 24); ("SM", 27); ("SA", 24); ("RS", 22); ("SK", 24); ("SI", 19);
                   ("ES", 24); ("SE", 24); ("CH", 21); ("TN", 24); ("TR", 26); ("AE", 23); ("GB", 22); ("VG", 24);
               ]
           let country = iban.Substring(0, Math.Min(2, iban.Length))
           match lengthPerCountry.TryGetValue(country) with
           | true, length ->   // country should have iban of this length
               if length = iban.Length then Some(iban) else None
           | _ -> None     // country not known
       )
   |~> (fun iban -> Some(iban.Substring(4) + iban.Substring(0,4)))
   |~> (fun iban ->
           let replaceBase36LetterWithBase10String (s : string) (c :char) = s.Replace(c.ToString(), ((int)c - (int)'A' + 10).ToString())
           Some(List.fold replaceBase36LetterWithBase10String iban [ 'A' .. 'Z' ]))
   |~> (fun iban ->    // iban mod 97
           // We could have used BigInteger, but with a loop by 7 char each 
           // over the long digit string we get away with Int32 arithmetic
           // (as described in the Wikipedia article)
           let reduceOnce r n = Int32.Parse(r.ToString() + n) % 97
           let rest =
               Regex.Matches(iban.Substring(2), @"\d{1,7}") |> Seq.cast |> Seq.map (fun x -> x.ToString())
               |> Seq.fold reduceOnce (reduceOnce 0 (iban.Substring(0,2)))
           // an iban needs a rest of 1
           if rest = 1 then Some(1) else None
       )
   |> function | Some(_) -> "a valid IBAN" | None -> "an invalid IBAN"
   |> printfn "%s is %s" iban

0</lang>

Output:
>Rosetta.exe "GB82 WEST 1234 5698 7654 32"
GB82 WEST 1234 5698 7654 32 is a valid IBAN

>Rosetta.exe "GB82 TEST 1234 5698 7654 32"
GB82 TEST 1234 5698 7654 32 is an invalid IBAN

Forth

Works with: 4tH version 3.62.3

<lang>include lib/ulcase.4th \ for S>UPPER include lib/triple.4th \ for UT/MOD include lib/cstring.4th \ for C/STRING include lib/todbl.4th \ for S>DOUBLE

0 constant ud>t \ convert unsigned double to triple 88529281 constant 97^4 \ first stage modulus char A 10 - negate +constant c>u \ convert character to IBAN digit

bank>t u>d rot 3 - 0 ?do 10 mu* loop 1000000000 ut* ;
                                      \ convert country part to unsigned
country>u ( a n -- u)
 c/string c>u 10000 * >r c/string c>u 100 * >r number 100 mod abs r> + r> +
                                      \ convert bank part to unsigned
bank>u \ a n -- u)
 c/string c>u 1000000 * >r            \ get first digit and shift
 c/string c>u 10000 * >r              \ get second digit and shift
 c/string c>u 100 * >r                \ get third digit and shift
 drop c@ c>u r> + r> + r> +           \ combine all digits to number
iban>t ( a n -- triple)
 s>upper                              \ convert to upper case and get country
 over 4 country>u >r 4 /string        \ get bank part, save length, convert
 over 4 bank>u >r 4 /string tuck s>double
 1000000 mu* r> -rot r> u>d d+ 2>r    \ now assemble everything except bank
 bank>t 2r> ud>t t+                   \ shift bank part and convert to triple
                                      ( a n -- f)
iban? iban>t 97^4 ut/mod 2drop 97 mod 1 = ;
                                      \ perform modulus 97 in two stages
checkiban ( --)
 ." Enter your IBAN: " refill drop 0 parse -trailing iban?
 if ." Valid" else ." Invalid" then cr

checkiban</lang>

Output:
linux:~> pp4th -x chkiban.4th
Enter your IBAN: GB82WEST12345698765432
Valid
linux:~> pp4th -x chkiban.4th
Enter your IBAN: GB82TEST12345698765432
Invalid

Fortran

<lang fortran> program ibancheck

  use ISO_FORTRAN_ENV
  implicit none
  character(4), dimension(75) :: cc = (/ &
           "AD24","AE23","AL28","AT20","AZ28","BA20","BE16","BG22","BH22","BR29", &
           "BY28","CH21","CR22","CY28","CZ24","DE22","DK18","DO28","EE20","ES24", &
           "FI18","FO18","FR27","GB22","GE22","GI23","GL18","GR27","GT28","HR21", &
           "HU28","IE22","IL23","IQ23","IS26","IT27","JO30","KW30","KZ20","LB28", &
           "LC32","LI21","LT20","LU20","LV21","MC27","MD24","ME22","MK19","MR27", &
           "MT31","MU30","NL18","NO15","PK24","PL28","PS29","PT25","QA29","RO24", &
           "RS22","SA24","SC31","SE24","SI19","SK24","SM27","ST25","SV28","TL23", &
           "TN24","TR26","UA29","VG24","XK20" /)
   character(34), dimension(12) :: ibans = (/ "GB82 WEST 1234 5698 7654 32       ", &
                                              "GB82WEST12345698765432            ", & 
                                              "gb82 west 1234 5698 7654 32       ", &
                                              "GB82 TEST 1234 5698 7654 32       ", &
                                              "GR16 0110 1250 0000 0001 2300 695 ", &
                                              "GB29 NWBK 6016 1331 9268 19       ", &
                                              "SA03 8000 0000 6080 1016 7519     ", &
                                              "CH93 0076 2011 6238 5295 7        ", &
                                              "IL62 0108 0000 0009 9999 999      ", &
                                              "IL62-0108-0000-0009-9999-999      ", &
                                              "US12 3456 7890 0987 6543 210      ", &
                                              "GR16 0110 1250 0000 0001 2300 695X" /)
   integer :: i
   
   do i=1, size(ibans)
       if (checkIBAN(trim(ibans(i)))) then
           print *, "  valid IBAN: ", trim(ibans(i))
       else
           print *, "invalid IBAN: ", trim(ibans(i))
       end if
   end do
   return

contains

   function checkIBAN(ibancode) result(valid)
       character(len=*), intent(in) :: ibancode
       character(len=len(ibancode)) :: iban
       logical :: valid
       integer(int32) :: j, ascii, ibanSize 
       character(100) :: ibanRearrange, ibantoint
       character(2) :: temp
       valid = .false.
       iban = remove_blanks(ibancode)
       ibanSize = checkCountryCode(iban)
       if (ibanSize == len(trim(iban))) then
           ibanRearrange = iban(5:ibanSize)//iban(1:4)
           ibantoint = ""
           do j=1, ibanSize
               ascii = ichar(ibanRearrange(j:j))
               if ((ascii >= 65) .and. (ascii<=90)) then
                   write (temp,fmt='(I2)') ascii-55
                   ibantoint = trim(ibantoint) // temp
               else
                   ibantoint = trim(ibantoint) // ibanRearrange(j:j)
               end if 
           end do
           if (mod97(ibantoint) == 1) then
               valid = .true.
           end if
       end if
   end function checkIBAN
   
   function mod97(strint) result(res)
       character(len=*), intent(in) :: strint
       integer :: i, num, res
       res = 0
       do  i=1, len(trim(strint))
           read(strint(i:i),*) num
           res = mod((res*10 + num),97);
       end do
   end function mod97
   function checkCountryCode(iban) result(ibanlength)
       character(len=*), intent(in) :: iban
       integer(int16) :: ibanlength, i
       ibanlength = 0
       do i=1, size(cc)
           if (iban(1:2) == cc(i)(1:2)) then
               read(cc(i)(3:4),*) ibanlength
               exit
           end if
       end do
   end function checkCountryCode

   Recursive Function Stripper(string,ch) Result(stripped)
       Implicit None
       character(len=*), intent(in) :: string
       character, intent(in) :: ch
       character(:), allocatable :: stripped
       IF (LEN(string)==1) THEN
          IF (string==ch) THEN 
             stripped = 
          ELSE
             stripped = string
          END IF
       ELSE
          IF (string(1:1)==ch) THEN
             stripped = stripper(string(2:),ch)
          ELSE
             stripped = string(1:1)//stripper(string(2:),ch)
          END IF
       END IF
   END Function stripper
   Function Remove_Blanks(string) Result(stripped)
       Implicit None
       character(len=*), intent(in) ::   string
       character(:), allocatable :: stripped
       stripped = trim(Stripper(trim(Stripper(string,' ')),achar(9)))
   END Function Remove_Blanks

end program ibancheck </lang>

Output:
   valid IBAN: GB82 WEST 1234 5698 7654 32
   valid IBAN: GB82WEST12345698765432
 invalid IBAN: gb82 west 1234 5698 7654 32
 invalid IBAN: GB82 TEST 1234 5698 7654 32
   valid IBAN: GR16 0110 1250 0000 0001 2300 695
   valid IBAN: GB29 NWBK 6016 1331 9268 19
   valid IBAN: SA03 8000 0000 6080 1016 7519
   valid IBAN: CH93 0076 2011 6238 5295 7
   valid IBAN: IL62 0108 0000 0009 9999 999
 invalid IBAN: IL62-0108-0000-0009-9999-999
 invalid IBAN: US12 3456 7890 0987 6543 210
 invalid IBAN: GR16 0110 1250 0000 0001 2300 695X

FreeBASIC

<lang freebasic>' FB 1.05.0 Win64

' List updated to release 72, 25 November 2016, of IBAN Registry (75 countries) Dim Shared countryCodes As String countryCodes = _

   "AD24 AE23 AL28 AT20 AZ28 BA20 BE16 BG22 BH22 BR29 BY28 CH21 CR22 CY28 CZ24 DE22 " _
   "DK18 DO28 EE20 ES24 FI18 FO18 FR27 GB22 GE22 GI23 GL18 GR27 GT28 HR21 HU28 IE22 " _
   "IL23 IQ23 IS26 IT27 JO30 KW30 KZ20 LB28 LC32 LI21 LT20 LU20 LV21 MC27 MD24 ME22 " _
   "MK19 MR27 MT31 MU30 NL18 NO15 PK24 PL28 PS29 PT25 QA29 RO24 RS22 SA24 SC31 SE24 " _
   "SI19 SK24 SM27 ST25 SV28 TL23 TN24 TR26 UA29 VG24 XK20"

Function checkCountryCode(cc As String) As Boolean

 Return Instr(countryCodes, cc) 

End Function

' To avoid having to use the GMP library, a piece-wise calculation is used Function mod97(s As String) As UInteger

 Dim r As UInteger = ValULng(Left(s, 9)) Mod 97
 Dim start As UInteger = 10 
 While start < Len(s)
   r = ValULng(r & Mid(s, start, 7)) Mod 97 
   start += 7
 Wend
 Return r

End Function

Function validateIban(iban As Const String) As Boolean

 ' remove spaces from IBAN
 Dim s As String = iban
 Dim count As Integer = 0
 For i As Integer = 0 To Len(s) - 1
   If s[i] = 32 Then
     For j As Integer = i + 1 To Len(s) - 1
        s[j - 1] = s[j] 
     Next
     count += 1
   End If
   If i = Len(s) - 1 - count Then Exit For
 Next i
 If count > 0 Then
   s[Len(s) - count] = 0
   Dim p As UInteger Ptr = CPtr(UInteger Ptr, @s)
   *(p + 1) = Len(s) - count change length of string in descriptor
 End If
 ' check country code
 Dim isValid As Boolean = checkCountryCode(Left(s, 2) + Str(Len(s)))
 If Not isValid Then Return False
 ' move first 4 characters to end 
 s = Mid(s, 5) + Left(s, 4)
 ' replace A to Z with numbers 10 To 35
 For i As Integer = Len(s) To 1 Step -1
   If s[i - 1] >= 65 AndAlso s[i - 1] <= 90 Then
     s = Left(s, i - 1) + Str(s[i - 1] - 55) + Mid(s, i + 1) 
   End If
 Next
 
 ' do mod97 calculation
 Return mod97(s) = 1   remainder needs to be 1 for validity

End Function

Dim As String ibans(1 To 2) = {"GB82 WEST 1234 5698 7654 32", "GB82 TEST 1234 5698 7654 32"} For i As Integer = 1 To 2

 Dim isValid As Boolean = validateIban(ibans(i))
 Print ibans(i); IIf(isValid, " : may be valid", " : is not valid")

Next

Print Print "Press any key to quit" Sleep</lang>

Output:
GB82 WEST 1234 5698 7654 32 : may be valid
GB82 TEST 1234 5698 7654 32 : is not valid

Go

<lang Go> package main

import ( "fmt" "strings" "strconv" "math/big" )

var lCode = map[string]int { "AL": 28, "AD": 24, "AT": 20, "AZ": 28, "BE": 16, "BH": 22, "BA": 20, "BR": 29,

 	"BG": 22, "CR": 21, "HR": 21, "CY": 28, "CZ": 24, "DK": 18, "DO": 28, "EE": 20,
 	"FO": 18, "FI": 18, "FR": 27, "GE": 22, "DE": 22, "GI": 23, "GR": 27, "GL": 18,
 	"GT": 28, "HU": 28, "IS": 26, "IE": 22, "IL": 23, "IT": 27, "KZ": 20, "KW": 30,
 	"LV": 21, "LB": 28, "LI": 21, "LT": 20, "LU": 20, "MK": 19, "MT": 31, "MR": 27,
 	"MU": 30, "MC": 27, "MD": 24, "ME": 22, "NL": 18, "NO": 15, "PK": 24, "PS": 29,
 	"PL": 28, "PT": 25, "RO": 24, "SM": 27, "SA": 24, "RS": 22, "SK": 24, "SI": 19,
 	"ES": 24, "SE": 24, "CH": 21, "TN": 24, "TR": 26, "AE": 23, "GB": 22, "VG": 24,

}

var sCode = map[string]int { "1": 1, "2": 2, "3": 3, "4": 4, "5": 5, "6": 6, "7": 7, "8": 8, "9": 9, "A": 10, "B": 11, "C": 12, "D": 13, "E": 14, "F": 15, "G": 16, "H": 17, "I": 18, "J": 19, "K": 20, "L": 21, "M": 22, "N": 23, "O": 24, "P": 25, "Q": 26, "R": 27, "S": 28, "T": 29, "U": 30, "V": 31, "W": 32, "X": 33, "Y": 34, "Z": 35, }

func main() {

var iban string var r, s, t, st []string u := new(big.Int) v := new(big.Int) w := new(big.Int)

iban = "GB82 TEST 1234 5698 7654 32" r = strings.Split(iban, " ") s = strings.Split(r[0], "") t = strings.Split(r[1], "")

st = []string{ strconv.Itoa(sCode[t[0]]), strconv.Itoa(sCode[t[1]]), strconv.Itoa(sCode[t[2]]), strconv.Itoa(sCode[t[3]]), strings.Join(r[2:6], ""), strconv.Itoa(sCode[s[0]]), strconv.Itoa(sCode[s[1]]), strings.Join(s[2:4], ""), }

u.SetString(strings.Join(st, ""), 10) v.SetInt64(97) w.Mod(u, v)

if w.Uint64() == 1 && lCode[strings.Join(s[0:2], "")] == len(strings.Join(r, "")) { fmt.Printf("IBAN %s looks good!\n", iban) } else { fmt.Printf("IBAN %s looks wrong!\n", iban) } } </lang>

IBAN GB82 WEST 1234 5698 7654 32 looks good!
IBAN GB82 TEST 1234 5698 7654 32 looks wrong!
IBAN CH93 0076 2011 6238 5295 7 looks good!

Groovy

<lang groovy>def validateIBAN(String iban) {

   def iso = [AL: 28, AD: 24, AT: 20, AZ: 28, BE: 16, BH: 22, BA: 20, BR: 29, BG: 22,
           HR: 21, CY: 28, CZ: 24, DK: 18, DO: 28, EE: 20, FO: 18, FI: 18, FR: 27, GE: 22, DE: 22, GI: 23,
           GL: 18, GT: 28, HU: 28, IS: 26, IE: 22, IL: 23, IT: 27, KZ: 20, KW: 30, LV: 21, LB: 28, LI: 21,
           LT: 20, LU: 20, MK: 19, MT: 31, MR: 27, MU: 30, MC: 27, MD: 24, ME: 22, NL: 18, NO: 15, PK: 24,
           PS: 29, PL: 28, PT: 25, RO: 24, SM: 27, SA: 24, RS: 22, SK: 24, SI: 19, ES: 24, SE: 24, CH: 21,
           TN: 24, TR: 26, AE: 23, GB: 22, VG: 24, GR: 27, CR: 21]
   iban = iban.replaceAll(/\s/, ).toUpperCase()
   if (iban.size() < 4 || iso[iban[0..1]] != iban.size()) return false
   iban = iban[4..-1] + iban[0..<4]
   def number = iban.collect { Character.digit(it as char, 36) }.join()
   (number as BigInteger).mod(97) == 1

}</lang>

Testing: <lang groovy>[ 'GB82 WEST 1234 5698 7654 32',

 'GB82 TEST 1234 5698 7654 32',
 'GB81 WEST 1234 5698 7654 32',
 'SA03 8000 0000 6080 1016 7519',
 'CH93 0076 2011 6238 5295 7' ].each { iban ->
   println "$iban is ${validateIBAN(iban) ? 'valid' : 'invalid'}"

}</lang>

Output:
GB82 WEST 1234 5698 7654 32 is valid
GB82 TEST 1234 5698 7654 32 is invalid
GB81 WEST 1234 5698 7654 32 is invalid
SA03 8000 0000 6080 1016 7519 is valid
CH93 0076 2011 6238 5295 7 is valid

Haskell

This program uses the Maybe and Either monads to handle failures. Values of type 'Maybe a' can contain 'Nothing' (no value) or 'Just a' (a value of type 'a'). Values of type 'Either a b' contain 'Left b' (usually indicating failure) or 'Right c' (usually indicating success). <lang Haskell>import Data.Char (toUpper) import Data.Maybe (fromJust)

validateIBAN :: String -> Either String String validateIBAN [] = Left "No IBAN number." validateIBAN xs =

   case lookupCountry of
       Nothing -> invalidBecause "Country does not exist."
       Just l  -> if length normalized /= l
                       then invalidBecause "Number length does not match."
                       else check
   where
       -- remove blanks and make all letters uppercase
       normalized = map toUpper $ concat $ words xs
       -- get the country code
       country = take 2 normalized
       -- search number length
       lookupCountry = lookup country countries
       countries :: [(String, Int)]
       countries = zip (words "AL AT BE BA BG HR CZ DO FO FR DE GR GT \
           \IS IL KZ LV LI LU MT MU MD NL PK PL RO SA SK ES CH TR GB \
           \AD AZ BH BR CR CY DK EE FI GE GI GL HU IE IT KW LB LT MK \
           \MR MC ME NO PS PT SM RS SI SE TN AE VG")
           [28,20,16,20,22,21,24,28,18,27,22,27,28,26,23,20,21,21,20,
           31,30,24,18,24,28,24,24,24,24,21,26,22,24,28,22,29,21,28,18,
           20,18,22,23,18,28,22,27,30,28,20,19,27,27,22,15,29,25,27,22,
           19,24,24,23,24]
       digits = ['0'..'9']
       letters = ['A'..'Z']
       -- letters to be replaced
       replDigits = zip letters $ map show [10..35]
       -- digits and letters allowed in the IBAN number
       validDigits = digits ++ letters
       -- see if all digits and letters in the IBAN number are allowed
       sane = all (`elem` validDigits) normalized
       -- take the first 4 digits from the number and put them at its end
       (p1, p2) = splitAt 4 normalized
       p3 = p2 ++ p1
       -- convert the letters to numbers and
       -- convert the result to an integer
       p4 :: Integer
       p4 = read $ concat $ map convertLetter p3
       convertLetter x | x `elem` digits = [x]
                       | otherwise       = fromJust $ lookup x replDigits
       -- see if the number is valid
       check = if sane
                   then if p4 `mod` 97 == 1
                           then Right xs
                           else invalidBecause "Validation failed."
                   else invalidBecause "Number contains illegal digits."
       invalidBecause reason = Left $ "Invalid IBAN number " ++ xs ++

": " ++ reason</lang>

Output:
validateIBAN "GB82 WEST 1234 5698 7654 32"
Right "GB82 WEST 1234 5698 7654 32"

validateIBAN "gb82 West 1234 5698 7654 32"
Right "gb82 West 1234 5698 7654 32"

validateIBAN "GB82 WEST 1234 5698 7654 31"
Left "Invalid IBAN number GB82 WEST 1234 5698 7654 31: Validation failed."

validateIBAN "GW82 WEST 1234 5698 7654 32"
Left "Invalid IBAN number GW82 WEST 1234 5698 7654 32: Country does not exist."

validateIBAN "GB82 WEST 1234 5698 7654 3"
Left "Invalid IBAN number GB82 WEST 1234 5698 7654 3: Number length does not match."

validateIBAN  "GB82 _EST 1234 5698 7654 32"
Left "Invalid IBAN number GB82 _EST 1234 5698 7654 32: Number contains illegal digits."

J

<lang J>NB. delete any blank characters delblk =. #~ ' '&~: NB. rearrange rot =. '00' ,~ 2&}. @: (2&|.) NB. characters -> "digits" dig =. a. {~ (a.i.'0')+i.10 dig =. dig,a. {~ (a.i.'A')+i.26 todig =. dig&i. coded =. [: ". 'x' ,~ delblk @: ": @: todig

NB. calculate check sum cs =: 98 - 97 | coded @: rot @: delblk f.

NB. check sum as text cstxt =. _2{. '0', [: ": cs NB. replace first two characters chgps =. [,2}.] NB. shift country code rotlc =. 2&|. NB. insert check digits (position 3 and 4) insertps =. chgps &.rotlc

NB. IBAN with newly calculated check digits ibancd =: (cstxt insertps ]) f.

NB. check / generate check digits ibancheck =: ] (]`('ok'"_) @. -:) ibancd

NB. groups of four characters insertblk =. #~ # $ 1 1 1 1j1"_ quads =: insertblk @: delblk f.

NB. IBAN iban =: quads @: ibancheck

</lang>

Output:
   iban 'GB82 WEST 1234 5698 7654 32'
ok
   iban 'GB99 WEST 1234 5698 7654 32'
GB82 WEST 1234 5698 7654 32
   iban 'GB?? WEST 1234 5698 7654 32'
GB82 WEST 1234 5698 7654 32

   iban 'GB??WEST12345698765432'     NB. blank characters don't matter
GB82 WEST 1234 5698 7654 32

Java

Works with: Java version 8+

<lang java>import java.math.BigInteger; import java.util.*;

public class IBAN {

   private static final String DEFSTRS = ""
           + "AL28 AD24 AT20 AZ28 BE16 BH22 BA20 BR29 BG22 "
           + "HR21 CY28 CZ24 DK18 DO28 EE20 FO18 FI18 FR27 GE22 DE22 GI23 "
           + "GL18 GT28 HU28 IS26 IE22 IL23 IT27 KZ20 KW30 LV21 LB28 LI21 "
           + "LT20 LU20 MK19 MT31 MR27 MU30 MC27 MD24 ME22 NL18 NO15 PK24 "
           + "PS29 PL28 PT25 RO24 SM27 SA24 RS22 SK24 SI19 ES24 SE24 CH21 "
           + "TN24 TR26 AE23 GB22 VG24 GR27 CR21";
   private static final Map<String, Integer> DEFINITIONS = new HashMap<>();
   static {
       for (String definition : DEFSTRS.split(" "))
           DEFINITIONS.put(definition.substring(0, 2), Integer.parseInt(definition.substring(2)));
   }
   public static void main(String[] args) {
       String[] ibans = {
               "GB82 WEST 1234 5698 7654 32",
               "GB82 TEST 1234 5698 7654 32",
               "GB81 WEST 1234 5698 7654 32",
               "SA03 8000 0000 6080 1016 7519",
               "CH93 0076 2011 6238 5295 7",
               "XX00 0000",
               "",
               "DE",
               "DE13 äöü_ 1234 1234 1234 12"};
       for (String iban : ibans)
           System.out.printf("%s is %s.%n", iban, validateIBAN(iban) ? "valid" : "not valid");
   }
   static boolean validateIBAN(String iban) {
       iban = iban.replaceAll("\\s", "").toUpperCase(Locale.ROOT);
       int len = iban.length();
       if (len < 4 || !iban.matches("[0-9A-Z]+") || DEFINITIONS.getOrDefault(iban.substring(0, 2), 0) != len)
           return false;
       iban = iban.substring(4) + iban.substring(0, 4);
       StringBuilder sb = new StringBuilder();
       for (int i = 0; i < len; i++)
           sb.append(Character.digit(iban.charAt(i), 36));
       BigInteger bigInt = new BigInteger(sb.toString());
       return bigInt.mod(BigInteger.valueOf(97)).intValue() == 1;
   }

}</lang>

Output:
GB82 WEST 1234 5698 7654 32 is valid.
GB82 TEST 1234 5698 7654 32 is not valid.
GB81 WEST 1234 5698 7654 32 is not valid.
SA03 8000 0000 6080 1016 7519 is valid.
CH93 0076 2011 6238 5295 7 is valid.
XX00 0000 is not valid.
 is not valid.
DE is not valid.
DE13 äöü_ 1234 1234 1234 12 is not valid.

JavaScript

<lang JavaScript>var ibanLen = { NO:15, BE:16, DK:18, FI:18, FO:18, GL:18, NL:18, MK:19, SI:19, AT:20, BA:20, EE:20, KZ:20, LT:20, LU:20, CR:21, CH:21, HR:21, LI:21, LV:21, BG:22, BH:22, DE:22, GB:22, GE:22, IE:22, ME:22, RS:22, AE:23, GI:23, IL:23, AD:24, CZ:24, ES:24, MD:24, PK:24, RO:24, SA:24, SE:24, SK:24, VG:24, TN:24, PT:25, IS:26, TR:26, FR:27, GR:27, IT:27, MC:27, MR:27, SM:27, AL:28, AZ:28, CY:28, DO:28, GT:28, HU:28, LB:28, PL:28, BR:29, PS:29, KW:30, MU:30, MT:31 }

function isValid(iban) { iban = iban.replace(/\s/g, ) if (!iban.match(/^[\dA-Z]+$/)) return false var len = iban.length if (len != ibanLen[iban.substr(0,2)]) return false iban = iban.substr(4) + iban.substr(0,4) for (var s=, i=0; i<len; i+=1) s+=parseInt(iban.charAt(i),36) for (var m=s.substr(0,15)%97, s=s.substr(15); s; s=s.substr(13)) m=(m+s.substr(0,13))%97 return m == 1 }

document.write(isValid('GB82 WEST 1234 5698 7654 32'), '
') // true document.write(isValid('GB82 WEST 1.34 5698 7654 32'), '
') // false document.write(isValid('GB82 WEST 1234 5698 7654 325'), '
') // false document.write(isValid('GB82 TEST 1234 5698 7654 32'), '
') // false document.write(isValid('SA03 8000 0000 6080 1016 7519'), '
') // true </lang>

Output:
true
false
false
false
true

jq

This implementation requires a version of jq with gsub.

The heart of the matter consists of just four lines of straightforward jq code:<lang jq>

  1. strip the input string of spaces and tabs:

gsub("[ \t]";"")

  1. check the string is ALPHAnumeric

| test("^[A-Z0-9]+$")

 # check its length is as determined by the country code:           
 and length == $lengths[.[0:2]] 
 # check the mod 97 criterion:
 and ( (.[4:] + .[0:4]) | letters2digits | remainder) == 1

</lang> This conciseness is achieved courtesy of the helper functions: letters2digits and remainder. These could be implemented as inner functions of the main function, but for clarity they are shown as top-level functions here. <lang jq>def letters2digits:

 65 as $A | 90 as $Z
 | ($A - 10) as $ten
 | explode
 | map( if $A <= . and . <= $Z
        then (. - $ten) | tostring
        else [.] | implode
        end )
 | join("");
  1. jq currently does not have unlimited-precision integer arithmetic
  2. and so we define a special-purpose "mod 97" filter:
  3. input: a string representing a decimal
  4. output: its remainder modulo 97 as a number

def remainder:

 if length < 15 then (.|tonumber) % 97
 else (.[0:14] | remainder | tostring) as $r1
      | ($r1 + .[14:]) | remainder
 end;
 

def is_valid_iban:

 {
   "AL": 28, "AD": 24, "AT": 20, "AZ": 28, "BE": 16, "BH": 22, "BA": 20, "BR": 29,
   "BG": 22, "CR": 21, "HR": 21, "CY": 28, "CZ": 24, "DK": 18, "DO": 28, "EE": 20,
   "FO": 18, "FI": 18, "FR": 27, "GE": 22, "DE": 22, "GI": 23, "GR": 27, "GL": 18,
   "GT": 28, "HU": 28, "IS": 26, "IE": 22, "IL": 23, "IT": 27, "KZ": 20, "KW": 30,
   "LV": 21, "LB": 28, "LI": 21, "LT": 20, "LU": 20, "MK": 19, "MT": 31, "MR": 27,
   "MU": 30, "MC": 27, "MD": 24, "ME": 22, "NL": 18, "NO": 15, "PK": 24, "PS": 29,
   "PL": 28, "PT": 25, "RO": 24, "SM": 27, "SA": 24, "RS": 22, "SK": 24, "SI": 19,
   "ES": 24, "SE": 24, "CH": 21, "TN": 24, "TR": 26, "AE": 23, "GB": 22, "VG": 24
 } as $lengths
 # Ignore spaces and tabs, and check input is ALPHAnumeric:
 | gsub("[ \t]";"")
 | test("^[A-Z0-9]+$")
     # Validate country code against expected length:
     and length == $lengths[.[0:2]]
     # Shift and convert:
     and ( (.[4:] + .[0:4]) | letters2digits | remainder) == 1 ;</lang>Examples<lang jq>

"GB82 WEST 1234 5698 7654 32" | is_valid_iban #=> true "GB82 TEST 1234 5698 7654 32" | is_valid_iban #=> false</lang>

Julia

Works with: Julia version 0.6

<lang julia>function validiban(iban::AbstractString)

   country2length = Dict(
       "AL" => 28, "AD" => 24, "AT" => 20, "AZ" => 28, "BE" => 16, "BH" => 22, "BA" => 20, "BR" => 29,
       "BG" => 22, "CR" => 21, "HR" => 21, "CY" => 28, "CZ" => 24, "DK" => 18, "DO" => 28, "EE" => 20,
       "FO" => 18, "FI" => 18, "FR" => 27, "GE" => 22, "DE" => 22, "GI" => 23, "GR" => 27, "GL" => 18,
       "GT" => 28, "HU" => 28, "IS" => 26, "IE" => 22, "IL" => 23, "IT" => 27, "KZ" => 20, "KW" => 30,
       "LV" => 21, "LB" => 28, "LI" => 21, "LT" => 20, "LU" => 20, "MK" => 19, "MT" => 31, "MR" => 27,
       "MU" => 30, "MC" => 27, "MD" => 24, "ME" => 22, "NL" => 18, "NO" => 15, "PK" => 24, "PS" => 29,
       "PL" => 28, "PT" => 25, "RO" => 24, "SM" => 27, "SA" => 24, "RS" => 22, "SK" => 24, "SI" => 19,
       "ES" => 24, "SE" => 24, "CH" => 21, "TN" => 24, "TR" => 26, "AE" => 23, "GB" => 22, "VG" => 24)
   # Ensure upper alphanumeric input.
   iban = replace(iban, r"\s", "")
   rst = ismatch(r"^[\dA-Z]+$", iban)
   # Validate country code against expected length.
   rst = rst && length(iban) == country2length[iban[1:2]]
   # Shift and convert.
   iban = iban[5:end] * iban[1:4]
   digs = parse(BigInt, join(parse(Int, ch, 36) for ch in iban))
   return rst && digs % 97 == 1

end</lang>

Output:
validiban("GB82 WEST 1234 5698 7654 32") = true
validiban("GB82 TEST 1234 5698 7654 32") = false

Kotlin

<lang scala>// version 1.0.6

import java.math.BigInteger

object Iban {

   /* List updated to release 73, January 2017, of IBAN Registry (75 countries) */
   private val countryCodes = 
       "AD24 AE23 AL28 AT20 AZ28 BA20 BE16 BG22 BH22 BR29 BY28 CH21 CR22 CY28 CZ24 DE22 " +
       "DK18 DO28 EE20 ES24 FI18 FO18 FR27 GB22 GE22 GI23 GL18 GR27 GT28 HR21 HU28 IE22 " +
       "IL23 IQ23 IS26 IT27 JO30 KW30 KZ20 LB28 LC32 LI21 LT20 LU20 LV21 MC27 MD24 ME22 " +
       "MK19 MR27 MT31 MU30 NL18 NO15 PK24 PL28 PS29 PT25 QA29 RO24 RS22 SA24 SC31 SE24 " +
       "SI19 SK24 SM27 ST25 SV28 TL23 TN24 TR26 UA29 VG24 XK20"
   private fun checkCountryCode(cc: String) = cc in countryCodes
   fun validate(iban: String): Boolean {
       // remove spaces from IBAN
       var s = iban.replace(" ", "")
       // check country code
       if (!checkCountryCode(s.substring(0, 2) + s.length)) return false

       // move first 4 characters to end 
       s = s.substring(4) + s.substring(0, 4)

       // replace A to Z with numbers 10 To 35
       for (ch in 'A'..'Z') s = s.replace(ch.toString(), (ch - 55).toInt().toString())
 
       // check whether mod 97 calculation gives a remainder of 1 
       return BigInteger(s) % BigInteger.valueOf(97L) == BigInteger.ONE      
   }   

}

fun main(args: Array<String>) {

   val ibans = arrayOf("GB82 WEST 1234 5698 7654 32", "GB82 TEST 1234 5698 7654 32")
   for (iban in ibans) {
        val isValid = Iban.validate(iban)
        println(iban + if(isValid) " may be valid" else " is not valid")
   }

}</lang>

Output:
GB82 WEST 1234 5698 7654 32 may be valid
GB82 TEST 1234 5698 7654 32 is not valid

Logtalk

<lang logtalk>

- object(iban).

:- info([ version is 0.1, author is 'Paulo Moura', date is 2015/10/11, comment is 'IBAN validation example using DCG rules.' ]).

:- public(valid/1).

valid(IBAN) :- phrase(iban, IBAN), !.

iban --> country_code(Code), check_digits(Check), bban(BBAN), {(BBAN*1000000 + Code*100 + Check) mod 97 =:= 1}.

country_code(Code) --> letter_digits(L1, D3, D2), letter_digits(L0, D1, D0), {country_code([L1, L0]), Code is D3*1000 + D2*100 + D1*10 + D0}.

check_digits(Check) --> digit(D1), digit(D0), {Check is D1*10 + D0}.

bban(BBAN) --> bban_codes(Digits), {digits_to_integer(Digits, BBAN, Count), Count =< 30}.

bban_codes(Ds) --> " ", bban_codes(Ds). bban_codes([D| Ds]) --> digit(D), bban_codes(Ds). bban_codes([D1, D0| Ds]) --> letter_digits(_, D1, D0), bban_codes(Ds). bban_codes([]) --> [].

digit(D) --> [C], {0'0 =< C, C =< 0'9, D is C - 0'0}.

letter_digits(C, D1, D0) --> [C], { ( 0'A =< C, C =< 0'Z -> D is C - 0'A + 10 ; 0'a =< C, C =< 0'z, D is C - 0'a + 10 ), D1 is D div 10, D0 is D mod 10 }.

digits_to_integer(Digits, BBAN, Count) :- digits_to_integer(Digits, 0, BBAN, 0, Count).

digits_to_integer([], BBAN, BBAN, Count, Count). digits_to_integer([Digit| Digits], BBAN0, BBAN, Count0, Count) :- BBAN1 is BBAN0 * 10 + Digit, Count1 is Count0 + 1, digits_to_integer(Digits, BBAN1, BBAN, Count1, Count).

country_code("AL"). country_code("AD"). country_code("AT"). country_code("AZ"). country_code("BE"). country_code("BH"). country_code("BA"). country_code("BR"). country_code("BG"). country_code("CR"). country_code("HR"). country_code("CY"). country_code("CZ"). country_code("DK"). country_code("DO"). country_code("EE"). country_code("FO"). country_code("FI"). country_code("FR"). country_code("GE"). country_code("DE"). country_code("GI"). country_code("GR"). country_code("GL"). country_code("GT"). country_code("HU"). country_code("IS"). country_code("IE"). country_code("IL"). country_code("IT"). country_code("KZ"). country_code("KW"). country_code("LV"). country_code("LB"). country_code("LI"). country_code("LT"). country_code("LU"). country_code("MK"). country_code("MT"). country_code("MR"). country_code("MU"). country_code("MC"). country_code("MD"). country_code("ME"). country_code("NL"). country_code("NO"). country_code("PK"). country_code("PS"). country_code("PL"). country_code("PT"). country_code("RO"). country_code("SM"). country_code("SA"). country_code("RS"). country_code("SK"). country_code("SI"). country_code("ES"). country_code("SE"). country_code("CH"). country_code("TN"). country_code("TR"). country_code("AE"). country_code("GB"). country_code("VG").

- end_object.

</lang> Testing: <lang logtalk> | ?- iban::valid("GB82 WEST 1234 5698 7654 32"). yes </lang>

Lua

<lang lua>local length= {

 AL=28, AD=24, AT=20, AZ=28, BH=22, BE=16, BA=20, BR=29, BG=22, CR=21,
 HR=21, CY=28, CZ=24, DK=18, DO=28, EE=20, FO=18, FI=18, FR=27, GE=22,
 DE=22, GI=23, GR=27, GL=18, GT=28, HU=28, IS=26, IE=22, IL=23, IT=27,
 JO=30, KZ=20, KW=30, LV=21, LB=28, LI=21, LT=20, LU=20, MK=19, MT=31,
 MR=27, MU=30, MC=27, MD=24, ME=22, NL=18, NO=15, PK=24, PS=29, PL=28,
 PT=25, QA=29, RO=24, SM=27, SA=24, RS=22, SK=24, SI=19, ES=24, SE=24,
 CH=21, TN=24, TR=26, AE=23, GB=22, VG=24

}

function validate(iban)

 iban=iban:gsub("%s","")
 local l=length[iban:sub(1,2)]
 if not l or l~=#iban or iban:match("[^%d%u]") then
   return false -- invalid character, country code or length
 end
 local mod=0
 local rotated=iban:sub(5)..iban:sub(1,4)
 for c in rotated:gmatch(".") do
   mod=(mod..tonumber(c,36)) % 97
 end
 return mod==1

end</lang>

M2000 Interpreter

We make a lambda function which return a string, with the input IBAN plus (Valid) or (Invalid) at the end.

<lang M2000 Interpreter> \\ IBAN checker Function MakeIBANfun$ {

     Inventory countrylength = "AL" := 28, "AD" := 24, "AT" := 20, "AZ" := 28, "BE" := 16, "BH" := 22, "BA" := 20, "BR" := 29
     Append  countrylength, "BG" := 22, "CR" := 21, "HR" := 21, "CY" := 28, "CZ" := 24, "DK" := 18, "DO" := 28, "EE" := 20
     Append  countrylength, "FO" := 18, "FI" := 18, "FR" := 27, "GE" := 22, "DE" := 22, "GI" := 23, "GR" := 27, "GL" := 18
     Append  countrylength, "GT" := 28, "HU" := 28, "IS" := 26, "IE" := 22, "IL" := 23, "IT" := 27, "KZ" := 20, "KW" := 30
     Append  countrylength, "LV" := 21, "LB" := 28, "LI" := 21, "LT" := 20, "LU" := 20, "MK" := 19, "MT" := 31, "MR" := 27
     Append  countrylength, "MU" := 30, "MC" := 27, "MD" := 24, "ME" := 22, "NL" := 18, "NO" := 15, "PK" := 24, "PS" := 29
     Append  countrylength, "PL" := 28, "PT" := 25, "RO" := 24, "SM" := 27, "SA" := 24, "RS" := 22, "SK" := 24, "SI" := 19
     Append  countrylength, "ES" := 24, "SE" := 24, "CH" := 21, "TN" := 24, "TR" := 26, "AE" := 23, "GB" := 22, "VG" := 24
     
    =Lambda$ countrylength (Iban0$)->{
           Iban$=Filter$(Ucase$(Iban0$), " ")
           Iban$=Filter$(Iban$, Filter$(Iban$,"ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789"))
           Def Decimal ch, c
           {            
                 If Not Exist(countrylength, Left$(Iban$,2)) Then Exit
                 length=Eval(countrylength)
                 If Not Len(Iban$)=length Then exit
                 Buffer ScanChar as Integer*length
                 Return ScanChar, 0:=Mid$(Iban$,5), length-4:=Mid$(Iban$,1,4)
           
                 For i=0 to length-1 {
                       ch=Eval(ScanChar, i)
                       if ch>=48 and ch<=57 then {
                             c = c*10+ch-48    
                       } else.if ch>=65 and ch<=90 then {
                             c = c*100+ch-55
                       } else c=-1: exit
                 }
                 c = c mod 97
           }
           =Iban0$ + If$(c=1 ->" (Valid)", " (Invalid)")
     }

} IbanCheck$=MakeIBANfun$() Print IbanCheck$("GB82 WEST 1234 5698 7654 32") ' valid Print IbanCheck$("GB82 TEST 1234 5698 7654 32") Print IbanCheck$("SA03 8000 0000 6080 1016 7519") ' valid Print IbanCheck$("GR16 0110 1250 0000 0001 2300 695X") Print IbanCheck$("MK11 2222 3333 4444 555") </lang>

Mathematica / Wolfram Language

<lang Mathematica>CountryCodes={{"AL",28},{"AD",24},{"AT",20},{"AZ",28},{"BE",16},{"BH",22},{"BA",20},{"BR",29},{"BG",22},{"CR",21},{"HR",21},{"CY",28},{"CZ",24},{"DK",18},{"DO",28},{"EE",20},{"FO",18},{"FI",18},{"FR",27},{"GE",22},{"DE",22},{"GI",23},{"GR",27},{"GL",18},{"GT",28},{"HU",28},{"IS",26},{"IE",22},{"IL",23},{"IT",27},{"KZ",20},{"KW",30},{"LV",21},{"LB",28},{"LI",21},{"LT",20},{"LU",20},{"MK",19},{"MT",31},{"MR",27},{"MU",30},{"MC",27},{"MD",24},{"ME",22},{"NL",18},{"NO",15},{"PK",24},{"PS",29},{"PL",28},{"PT",25},{"RO",24},{"SM",27},{"SA",24},{"RS",22},{"SK",24},{"SI",19},{"ES",24},{"SE",24},{"CH",21},{"TN",24},{"TR",26},{"AE",23},{"GB",22},{"VG",24}}; ClearAll[IBANVerify] IBANVerify[input_String]:=Module[{i,cc,rules},

i=StringReplace[StringTrim[input],{" "->"","\t"->""}];
cc=StringTake[i,2];
If[MemberQ[CountryCodesAll,1,cc]
,
 cc=Select[CountryCodes,First[#]==cc&]1,2;
 If[cc==StringLength[i]
 ,
  i=StringRotateLeft[i,4];
  i=Characters[ToUpperCase[i]];
  rules=Rule@@@({CharacterRange["A","Z"],Range[10,35]}\[Transpose]);
  i=i/.rules;
  i=ToExpression/@i;
  i=FromDigits[Flatten[IntegerDigits/@i]];
  If[Mod[i,97]===1
  ,
   True
  ,
   False
  ]
 ,
  False
 ]
,
 False
]

]</lang> Trying out the function: <lang Mathematica>IBANVerify["GB82 WEST 1234 5698 7654 32"] IBANVerify["GB82 WEST 1234 5698 7654 323"] IBANVerify["GB82 WEST 1234 5698 7654 31"]

IBANVerify["XX82 WEST 1234 5698 7654 323"]</lang>

Output:
True
False
False
False

MATLAB

Didn't check country codes, lengths, or consistent checksums to keep this applicable to any new countries. <lang MATLAB>function valid = validateIBAN(iban) % Determine if International Bank Account Number is valid IAW ISO 13616 % iban - string containing account number

   if length(iban) < 5
       valid = false;
   else
       iban(iban == ' ') = ;                     % Remove spaces
       iban = lower([iban(5:end) iban(1:4)])+0;	% Rearrange and convert
       iban(iban > 96 & iban < 123) = iban(iban > 96 & iban < 123)-87; % Letters
       iban(iban > 47 & iban < 58) = iban(iban > 47 & iban < 58)-48;   % Numbers
       valid = piecewiseMod97(iban) == 1;
   end

end

function result = piecewiseMod97(x) % Conduct a piecewise version of mod(x, 97) to support large integers % x is a vector of integers

   x = sprintf('%d', x);	% Get to single-digits per index
   nDig = length(x);
   i1 = 1;
   i2 = min(9, nDig);
   prefix = ;
   while i1 <= nDig
       y = str2double([prefix x(i1:i2)]);
       result = mod(y, 97);
       prefix = sprintf('%d', result);
       i1 = i2+1;
       i2 = min(i1+8, nDig);
   end

end</lang>Usage: <lang MATLAB>tests = {'GB82 WEST 1234 5698 7654 32' ; 'GB82 TEST 1234 5698 7654 32' ; 'CH93 0076 2011 6238 5295 7' ; 'SA03 8000 0000 6080 1016 7519' ; 'SA03 1234 5678 9101 1121 3141' ; 'GB29 NWBK 6016 1331 9268 19' ; 'GB29' ; 'GR16 0110 1250 0000 0001 2300 695'}; for k = 1:length(tests) fprintf('%s -> %svalid\n', tests{k}, char(~validateIBAN(tests{k}).*'in'))

end</lang>

Output:
GB82 WEST 1234 5698 7654 32 -> valid
GB82 TEST 1234 5698 7654 32 -> invalid
CH93 0076 2011 6238 5295 7 -> valid
SA03 8000 0000 6080 1016 7519 -> valid
SA03 1234 5678 9101 1121 3141 -> invalid
GB29 NWBK 6016 1331 9268 19 -> valid
GB29 -> invalid
GR16 0110 1250 0000 0001 2300 695 -> valid

NewLISP

<lang NewLISP> (setq *iban-code-length* '((15 ("NO"))

                            (16  ("BE")) 
                            (18  ("DK" "FO" "FI" "GL" "NL"))
                            (19  ("MK" "SI"))
                            (20  ("AT" "BA" "EE" "KZ" "LT" "LU"))
                            (21  ("CR" "HR" "LV" "LI" "CH"))
                            (22  ("BH" "BG" "GE" "DE" "IE" "ME" "RS" "GB"))
                            (23  ("GI" "IL" "AE"))
                            (24  ("AD" "CZ" "MD" "PK" "RO" "SA" "SK" "ES" "SE" "TN" "VG"))
                            (25  ("PT"))
                            (26  ("IS" "TR"))
                            (27  ("FR" "GR" "IT" "MR" "MC" "SM"))
                            (28  ("AL" "AZ" "CY" "DO" "GT" "HU" "LB" "PL"))
                            (29  ("BR" "PS"))
                            (30  ("KW" "MU"))
                            (31  ("MT"))))


- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Remove spaces and set upper case.

(define (sanitize-iban iban)

  (upper-case (replace " " iban ""))

)

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Check that only A-Z and 0-9 are used.

(define (valid-chars? iban) (setq rx (string "[A-Z0-9]{" (length iban) "}" )) (regex rx iban 1) )

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Check that the length is correct for the country.

(define (valid-length? iban) (setq countries-found (lookup (int (length iban)) *iban-code-length*)) (if (not (nil? countries-found)) (member (0 2 iban) countries-found) ) )

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Convert the IBAN to integer following the rules from Wikipedia.

(define (iban-to-integer iban)

   (setq country-code (0 2 iban))
   (setq checksum (2 2 iban))
   (setq iban (string (4 iban) country-code))
   (setq iban (join (map (lambda (x) (if (regex "[0-9]" x) x (string (- (char x) 55)))) (explode iban))))
   (bigint (string iban checksum))

)

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Test if IBAN is correct (true) or not (nil)
(valid-iban? "GB82 WEST 1234 5698 7654 32") ==> true
(valid-iban? "GB82 TEST 1234 5698 7654 32") ==> nil

(define (valid-iban? iban)

   (setq iban (sanitize-iban iban))
   (and
       (valid-chars? iban)
       (valid-length? iban)
       (= 1L (% (iban-to-integer iban) 97))
   )

) </lang> Output:

(valid-iban? "GB82 WEST 1234 5698 7654 32")
true

(valid-iban? "GB82 TEST 1234 5698 7654 32")
nil

Nim

Library: bigints

<lang nim>import tables, strutils, re, bigints

let countryLen = toTable({

 "AL": 28, "AD": 24, "AT": 20, "AZ": 28, "BE": 16, "BH": 22, "BA": 20, "BR": 29,
 "BG": 22, "CR": 21, "HR": 21, "CY": 28, "CZ": 24, "DK": 18, "DO": 28, "EE": 20,
 "FO": 18, "FI": 18, "FR": 27, "GE": 22, "DE": 22, "GI": 23, "GR": 27, "GL": 18,
 "GT": 28, "HU": 28, "IS": 26, "IE": 22, "IL": 23, "IT": 27, "KZ": 20, "KW": 30,
 "LV": 21, "LB": 28, "LI": 21, "LT": 20, "LU": 20, "MK": 19, "MT": 31, "MR": 27,
 "MU": 30, "MC": 27, "MD": 24, "ME": 22, "NL": 18, "NO": 15, "PK": 24, "PS": 29,
 "PL": 28, "PT": 25, "RO": 24, "SM": 27, "SA": 24, "RS": 22, "SK": 24, "SI": 19,
 "ES": 24, "SE": 24, "CH": 21, "TN": 24, "TR": 26, "AE": 23, "GB": 22, "VG": 24})

proc validIban(iban: string): bool =

 # Ensure upper alphanumeric input
 var iban = iban.replace(" ","").replace("\t","")
 if not iban.match(re"^[\dA-Z]+$"):
   return false
 # Validate country code against expected length
 if iban.len != countryLen[iban[0..1]]:
   return false
 # Shift and convert
 iban = iban[4..iban.high] & iban[0..3]
 var digits = ""
 for ch in iban:
   case ch
     of '0'..'9': digits.add($(ch.ord - '0'.ord))
     of 'A'..'Z': digits.add($(ch.ord - 'A'.ord + 10))
     else: discard
 result = initBigInt(digits) mod 97 == 1

for account in ["GB82 WEST 1234 5698 7654 32", "GB82 TEST 1234 5698 7654 32"]:

echo account, " validation is: ", validIban account</lang>

Output:
GB82 WEST 1234 5698 7654 32 validation is: true
GB82 TEST 1234 5698 7654 32 validation is: false

Oberon-2

Works with oo2c Version 2 <lang oberon2> MODULE IBAN; IMPORT

 Out,
 Err,
 ADT:Dictionary,
 Object:Boxed,
 Object:BigInt,
 Object,
 Strings,
 IntStr;

TYPE

 IBANLen = Boxed.LongInt;

VAR

 nations: Dictionary.Dictionary(STRING,IBANLen);
 
 PROCEDURE Check*(iban: ARRAY OF CHAR): BOOLEAN;
 VAR
   country,ibanStr: Object.String;
   nLetter: ARRAY 3 OF CHAR;
   block: ARRAY 5 OF CHAR;
   numIban: ARRAY 256 OF CHAR;
   num,den,res: BigInt.BigInt;
   ibanLen: IBANLen;
   i: LONGINT;
 BEGIN
   ibanStr := Object.NewLatin1(iban);
   country := ibanStr.Substring(0,2);
   IF ~nations.HasKey(country) THEN
     Err.Object("Country " + country + " has not IBAN codes. ");
     RETURN FALSE;
   END;
   ibanLen := nations.Get(country);
   
   IF SHORT(ibanLen.value) # Strings.Length(iban) THEN
     Err.Object("IBAN length incorrect for " + country +". ");
     RETURN FALSE
   END;
   
   block[0] := 0X;
   Strings.Extract(iban,0,4,block);
   Strings.Delete(iban,0,4);Strings.Append(block,iban);
   numIban[0] := 0X;
   FOR i := 0 TO LEN(iban) - 1 DO
     nLetter[0] := 0X;
     IF (iban[i] >= 'A') & (iban[i] <= 'Z') THEN
       IntStr.IntToStr(ORD(iban[i]) - ORD('A') + 10,nLetter);
     ELSE
       nLetter[0] := iban[i];
       nLetter[1] := 0X
     END;
     Strings.Append(nLetter,numIban);
   END;
   Strings.Append(0X,numIban);
   
   num := BigInt.New(Object.NewLatin1(numIban),10);
   den := BigInt.New("97",10);
   res := num.Mod(den);
   IF res.Equals(BigInt.one) THEN 
     RETURN TRUE
   ELSE
     Err.String("IBAN code check failed. ");
     RETURN FALSE
   END
 END Check;
 
 PROCEDURE CodeLengthFor*(country: ARRAY OF CHAR): LONGINT;
 VAR
   countryStr: Object.String;
   ibanLen: IBANLen;
 BEGIN
   countryStr := Object.NewLatin1(country);
   ibanLen := Boxed.zeroLongInt;
   IF nations.HasKey(countryStr) THEN
     ibanLen := nations.Get(countryStr)
   END;
   RETURN ibanLen.value
 END CodeLengthFor;
 
 PROCEDURE Test*;
   PROCEDURE DoCheck(iban: ARRAY OF CHAR);
   BEGIN
     Out.String("IBAN[");Out.String(iban);Out.String("]=");Out.Bool(Check(iban));
     Out.Ln
   END DoCheck;
 BEGIN
   DoCheck("CH9300762011623852957");
   DoCheck("GB82WEST12345698765432");
   DoCheck("SA0380000000608010167519");
   DoCheck("XX0380000000608010167519");
 END Test;
 

BEGIN

 nations := NEW(Dictionary.Dictionary(STRING,Boxed.LongInt));
 nations.Set("AL",NEW(IBANLen,28));
 nations.Set("AD",NEW(IBANLen,24));
 nations.Set("AT",NEW(IBANLen,20));
 nations.Set("AZ",NEW(IBANLen,28));
 nations.Set("BE",NEW(IBANLen,16));
 nations.Set("BH",NEW(IBANLen,22));
 nations.Set("BA",NEW(IBANLen,20));
 nations.Set("BR",NEW(IBANLen,29));
 nations.Set("BG",NEW(IBANLen,22));
 nations.Set("CR",NEW(IBANLen,21));
 nations.Set("HR",NEW(IBANLen,21));
 nations.Set("CY",NEW(IBANLen,28));
 nations.Set("CZ",NEW(IBANLen,24));
 nations.Set("DK",NEW(IBANLen,18));
 nations.Set("DO",NEW(IBANLen,28));
 nations.Set("EE",NEW(IBANLen,20));
 nations.Set("FO",NEW(IBANLen,18));
 nations.Set("FI",NEW(IBANLen,18));
 nations.Set("FR",NEW(IBANLen,27));
 nations.Set("GE",NEW(IBANLen,22));
 nations.Set("DE",NEW(IBANLen,22));
 nations.Set("GI",NEW(IBANLen,23));
 nations.Set("GR",NEW(IBANLen,27));
 nations.Set("GL",NEW(IBANLen,18));  
 nations.Set("GT",NEW(IBANLen,28));
 nations.Set("HU",NEW(IBANLen,28));
 nations.Set("IS",NEW(IBANLen,26));
 nations.Set("IE",NEW(IBANLen,22));
 nations.Set("IL",NEW(IBANLen,23));
 nations.Set("IT",NEW(IBANLen,27));
 nations.Set("KZ",NEW(IBANLen,20));
 nations.Set("KW",NEW(IBANLen,30));
 nations.Set("LV",NEW(IBANLen,21));
 nations.Set("LB",NEW(IBANLen,28));
 nations.Set("LI",NEW(IBANLen,21));
 nations.Set("LT",NEW(IBANLen,20));
 nations.Set("LU",NEW(IBANLen,20));
 nations.Set("MK",NEW(IBANLen,19));
 nations.Set("MT",NEW(IBANLen,31));
 nations.Set("MR",NEW(IBANLen,27));
 nations.Set("MU",NEW(IBANLen,30));
 nations.Set("MC",NEW(IBANLen,27));
 nations.Set("MD",NEW(IBANLen,24));
 nations.Set("ME",NEW(IBANLen,22));
 nations.Set("NL",NEW(IBANLen,18));
 nations.Set("NO",NEW(IBANLen,15));
 nations.Set("PK",NEW(IBANLen,24));
 nations.Set("PS",NEW(IBANLen,29));
 nations.Set("PL",NEW(IBANLen,28));
 nations.Set("PT",NEW(IBANLen,25));
 nations.Set("RO",NEW(IBANLen,24));
 nations.Set("SM",NEW(IBANLen,27));
 nations.Set("SA",NEW(IBANLen,24));
 nations.Set("RS",NEW(IBANLen,22));
 nations.Set("SK",NEW(IBANLen,24));
 nations.Set("SI",NEW(IBANLen,19));
 nations.Set("ES",NEW(IBANLen,24));
 nations.Set("SE",NEW(IBANLen,24));
 nations.Set("CH",NEW(IBANLen,21));
 nations.Set("TN",NEW(IBANLen,24));
 nations.Set("TR",NEW(IBANLen,26));
 nations.Set("AE",NEW(IBANLen,23));
 nations.Set("GB",NEW(IBANLen,22));
 nations.Set("VG",NEW(IBANLen,24));
 
 Test;

END IBAN. </lang> Output:

IBAN[CH9300762011623852957]=TRUE
IBAN[GB82WEST12345698765432]=TRUE
IBAN[SA0380000000608010167519]=TRUE
IBAN[XX0380000000608010167519]=Country XX not has IBAN codes. FALSE


OCaml

Works with: OCaml version 4.03+

<lang ocaml>

  1. load "str.cma"
  2. load "nums.cma" (* for module Big_int *)


(* Countries and length of their IBAN. *) (* Taken from https://en.wikipedia.org/wiki/International_Bank_Account_Number#IBAN_formats_by_country *) let countries = [

 ("AL", 28); ("AD", 24); ("AT", 20); ("AZ", 28); ("BH", 22); ("BE", 16);
 ("BA", 20); ("BR", 29); ("BG", 22); ("CR", 21); ("HR", 21); ("CY", 28);
 ("CZ", 24); ("DK", 18); ("DO", 28); ("TL", 23); ("EE", 20); ("FO", 18);
 ("FI", 18); ("FR", 27); ("GE", 22); ("DE", 22); ("GI", 23); ("GR", 27);
 ("GL", 18); ("GT", 28); ("HU", 28); ("IS", 26); ("IE", 22); ("IL", 23);
 ("IT", 27); ("JO", 30); ("KZ", 20); ("XK", 20); ("KW", 30); ("LV", 21);
 ("LB", 28); ("LI", 21); ("LT", 20); ("LU", 20); ("MK", 19); ("MT", 31);
 ("MR", 27); ("MU", 30); ("MC", 27); ("MD", 24); ("ME", 22); ("NL", 18);
 ("NO", 15); ("PK", 24); ("PS", 29); ("PL", 28); ("PT", 25); ("QA", 29);
 ("RO", 24); ("SM", 27); ("SA", 24); ("RS", 22); ("SK", 24); ("SI", 19);
 ("ES", 24); ("SE", 24); ("CH", 21); ("TN", 24); ("TR", 26); ("AE", 23);
 ("GB", 22); ("VG", 24); ("DZ", 24); ("AO", 25); ("BJ", 28); ("BF", 27);
 ("BI", 16); ("CM", 27); ("CV", 25); ("IR", 26); ("CI", 28); ("MG", 27);
 ("ML", 28); ("MZ", 25); ("SN", 28); ("UA", 29)

] (* Put the countries in a Hashtbl for faster search... *) let tbl_countries =

 let htbl = Hashtbl.create (List.length countries) in
 let _ = List.iter (fun (k, v) -> Hashtbl.add htbl k v) countries in
 htbl


(* Delete spaces and put all letters in upper case. *) let clean_iban iban =

 Str.global_replace (Str.regexp " +") "" iban
 |> String.uppercase_ascii


(* Each country has an IBAN with a specific length. *) let check_length ib =

 let iso_length = List.hd countries |> fst |> String.length in
 let country_code = String.sub ib 0 iso_length in
 try
   Hashtbl.find tbl_countries country_code = String.length ib
 with
   Not_found -> false


(* Convert a string into a list of chars. *) let charlist_of_string s =

 let l = String.length s in
 let rec doloop i =
   if i >= l then []
   else s.[i] :: doloop (i + 1)
 in
 doloop 0


(* Letters are associated to values: A=10, B=11, ..., Z=35. *) let val_of_char c =

 match c with
 | '0' .. '9' -> int_of_char c - int_of_char '0'
 | 'A' .. 'Z' -> int_of_char c - int_of_char 'A' + 10
 | _ -> failwith (Printf.sprintf "Character not allowed: %c" c)


(* Compute the mod-97 value and check it is equal to 1. *) let check_mod97 ib =

 let l = String.length ib
 and taken = 4 in
 let prefix = String.sub ib 0 taken
 and rest = String.sub ib taken (l - taken) in
 let newval = rest ^ prefix (* move the 4 initial characters to the end of the string *)
           |> charlist_of_string  (* convert the string into a list of chars *)
           |> List.map val_of_char  (* convert each char into its integer value *)
           |> List.map string_of_int  (* convert the integers into strings... *)
           |> List.fold_left (^) "" in  (* ...and concatenate said strings *)
 (* Now compute the mod-97 using the Big Integers provided by OCaml, and
  * compare the result to 1. *)
 Big_int.eq_big_int
   (Big_int.mod_big_int (Big_int.big_int_of_string newval)
                        (Big_int.big_int_of_int 97))
   (Big_int.big_int_of_int 1)


(* Do the validation as described in the Wikipedia article at

* https://en.wikipedia.org/wiki/International_Bank_Account_Number#Validating_the_IBAN *)

let validate iban =

 let ib = clean_iban iban in
 check_length ib && check_mod97 ib


let () =

 let ibans = [
   ("GB82 WEST 1234 5698 7654 32", true);
   ("GB82 TEST 1234 5698 7654 32", false);
   ("GB81 WEST 1234 5698 7654 32", false);
   ("GB82 WEST 1234 5698 7654 3", false);
   ("SA03 8000 0000 6080 1016 7519", true);
   ("CH93 0076 2011 6238 5295 7", true);
   ("\"Completely incorrect iban\"", false)
 ] in
 let testit (ib, exp) =
   let res = validate ib in
   Printf.printf "%s is %svalid. Expected %b [%s]\n"
                 ib (if res then "" else "not ")
                 exp (if res = exp then "PASS" else "FAIL")
 in 
 List.iter (fun pair -> testit pair) ibans

</lang>

Output:
GB82 WEST 1234 5698 7654 32 is valid. Expected true [PASS]
GB82 TEST 1234 5698 7654 32 is not valid. Expected false [PASS]
GB81 WEST 1234 5698 7654 32 is not valid. Expected false [PASS]
GB82 WEST 1234 5698 7654 3 is not valid. Expected false [PASS]
SA03 8000 0000 6080 1016 7519 is valid. Expected true [PASS]
CH93 0076 2011 6238 5295 7 is valid. Expected true [PASS]
"Completely incorrect iban" is not valid. Expected false [PASS]


Perl

<lang Perl>#!/usr/bin/perl use strict ; use warnings ; use Math::BigInt ;

my %countrycodelengths = ( "AL" => 28, "AD" => 24, "AT" => 20, "AZ" => 28,

                          "BE" =>  16, "BH" =>  22, "BA" =>  20, "BR" =>  29,
                          "BG" =>  22, "CR" =>  21, "HR" =>  21, "CY" =>  28,

"CZ" => 24, "DK" => 18, "DO" => 28, "EE" => 20, "FO" => 18, "FI" => 18, "FR" => 27, "GE" => 22, "DE" => 22, "GI" => 23, "GR" => 27, "GL" => 18, "GT" => 28, "HU" => 28, "IS" => 26, "IE" => 22, "IL" => 23, "IT" => 27, "KZ" => 20, "KW" => 30, "LV" => 21, "LB" => 28, "LI" => 21, "LT" => 20, "LU" => 20, "MK" => 19, "MT" => 31, "MR" => 27, "MU" => 30, "MC" => 27, "MD" => 24, "ME" => 22, "NL" => 18, "NO" => 15, "PK" => 24, "PS" => 29, "PL" => 28, "PT" => 25, "RO" => 24, "SM" => 27, "SA" => 24, "RS" => 22, "SK" => 24, "SI" => 19, "ES" => 24, "SE" => 24, "CH" => 21, "TN" => 24, "TR" => 26, "AE" => 23, "GB" => 22, "VG" => 24 ) ; sub validate_iban {

  my $ibanstring = shift ;
  $ibanstring =~ s/\s+//g ;
  return 0 unless $ibanstring =~ /[0-9a-zA-Z]+/ ;
  $ibanstring = uc $ibanstring ;
  return 0 if ( not exists $countrycodelengths{ substr( $ibanstring , 0 , 2 ) }  );
  return 0 if length ( $ibanstring ) != $countrycodelengths{ substr( $ibanstring , 0 , 2 ) } ;
  $ibanstring =~ s/(.{4})(.+)/$2$1/ ;
  $ibanstring =~ s/([A-Z])/ord( $1 ) - 55/eg ;
  my $number = Math::BigInt->new( $ibanstring ) ;
  if ( $number->bmod( 97 ) == 1 ) {
     return 1 ;
  }
  else {
     return 0 ;
  }

}

if ( validate_iban( "GB82 WEST 1234 5698 7654 32" ) ) {

  print "GB82 WEST 1234 5698 7654 32 is a valid IBAN number!\n" ;

} else {

  print "Sorry! GB82 WEST 1234 5698 7654 32 is not valid!\n" ;

} if ( validate_iban( "GB82TEST12345698765432" ) ) {

  print "GB82TEST12345698765432 is valid!\n" ;

}</lang>

Output:
GB82 WEST 1234 5698 7654 32 is a valid IBAN number!
GB82TEST12345698765432 is invalid!

Perl 6

<lang perl6>subset IBAN of Str where sub ($_ is copy) {

   s:g/\s//;
   return False if m/<-[ 0..9 A..Z a..z ]>/ or .chars != <
       AD 24 AE 23 AL 28 AT 20 AZ 28 BA 20 BE 16 BG 22 BH 22 BR 29 CH 21
       CR 21 CY 28 CZ 24 DE 22 DK 18 DO 28 EE 20 ES 24 FI 18 FO 18 FR 27
       GB 22 GE 22 GI 23 GL 18 GR 27 GT 28 HR 21 HU 28 IE 22 IL 23 IS 26
       IT 27 KW 30 KZ 20 LB 28 LI 21 LT 20 LU 20 LV 21 MC 27 MD 24 ME 22
       MK 19 MR 27 MT 31 MU 30 NL 18 NO 15 PK 24 PL 28 PS 29 PT 25 RO 24
       RS 22 SA 24 SE 24 SI 19 SK 24 SM 27 TN 24 TR 26 VG 24
   >.hash{.substr(0,2).uc};

   s/(.**4)(.+)/$1$0/;
   return .subst(:g, /\D/, { :36(~$_) }) % 97 == 1;

}

say "$_ is {$_ ~~ IBAN ?? 'valid' !! 'invalid' }" for 'GB82 WEST 1234 5698 7654 32', 'gb82 west 1234 5698 7654 32',

'GB82 TEST 1234 5698 7654 32';</lang>

Output:
GB82 WEST 1234 5698 7654 32 is valid.
gb82 west 1234 5698 7654 32 is valid.
GB82 TEST 1234 5698 7654 32 is invalid.

Phix

<lang Phix>-- -- demo\rosetta\IBAN.exw -- ===================== -- constant nations = {{"AD",24}, -- Andorra

                   -- (full list in distro)
                   {"CH",21},  -- Switzerland
                   {"GB",22},  -- United Kingdom
                   {"SA",24},  -- Saudi Arabia 
                   {"XK",20}}  -- Kosovo

constant {countries,lengths} = columnize(nations)

function iban(string code) -- This routine does and should reject codes containing spaces etc. -- Use iban_s() below for otherwise.

   integer country = find(code[1..2],countries)
   if country!=0
   and length(code)=lengths[country] then
       code = code[5..$]&code[1..4]
       integer c = 0
       for i=1 to length(code) do
           integer ch=code[i]
           if ch>='0' and ch<='9' then
               c = c*10+ch-'0'
           elsif ch>='A' and ch<='Z' then
               c = c*100+ch-55
           else
               return false
           end if
           c = mod(c,97)
       end for
       return c=1
   end if
   return false

end function

function iban_s(string code) -- strips any embedded spaces and hyphens before validating.

   code = substitute_all(code,{" ","-"},{"",""})
   return iban(code)

end function

procedure test(string code, bool expected)

   bool valid = iban_s(code)
   string state
   if valid=expected then
       state = iff(valid?"ok":"invalid (as expected)")
   else
       state = iff(valid?"OK!!":"INVALID!!")&" (NOT AS EXPECTED)"
   end if
   printf(1,"%-34s :%s\n",{code,state})

end procedure

test("GB82 WEST 1234 5698 7654 32",true) test("GB82 TEST 1234 5698 7654 32",false) test("GB81 WEST 1234 5698 7654 32",false) test("SA03 8000 0000 6080 1016 7519",true) test("CH93 0076 2011 6238 5295 7",true)</lang>

Output:
GB82 WEST 1234 5698 7654 32        :ok
GB82 TEST 1234 5698 7654 32        :invalid (as expected)
GB81 WEST 1234 5698 7654 32        :invalid (as expected)
SA03 8000 0000 6080 1016 7519      :ok
CH93 0076 2011 6238 5295 7         :ok

PHP

<lang php> <?php

function piece_wise($iban_all_digits) {

   $remainder = NULL;
   $slice = 9;
   
   for ($i=0; $i<strlen($iban_all_digits); $i=$i+$slice)
   {
       if ($i>0)
       {
           $slice = 7;
       } 
       
       $part = $remainder . substr($iban_all_digits, $i, $slice);
       //echo "REMAINDER: " . $remainder . "
"; //echo "PART: $part" . "
"; $remainder = intval($part) % 97; }

return $remainder;

}


$iban = "GB82 WEST 1234 5698 7654 32";

//remove space $iban = str_replace(' ', , $iban);

//echo $iban; echo '
'; $iban_length = strlen($iban); $country_code = substr($iban, 0, 2);

/*

   IBAN lengths are country specific 
   full list available at
   https://en.wikipedia.org/wiki/International_Bank_Account_Number#IBAN_formats_by_country
  • /

$lengths = ['GB' => 22];


if ($lengths[$country_code] != $iban_length) {

   exit ("IBAN length not valid for $country_code");

}


// 2. move first four characters to the end $iban = substr($iban, 4) . substr($iban, 0, 4);


//3. Replace letters in IBAN with digits //(A=10, B=11 ... Z=35)

$iban_arr = str_split($iban, 1);


$iban_all_digits = ;

foreach ($iban_arr as $key=>$value) {

   if (ctype_alpha($value)) 
   {
       $value = ord($value) - 55;
   }
   $iban_all_digits = $iban_all_digits . $value;

}


if (piece_wise($iban_all_digits) === 1) {

   echo "VALID IBAN!";

}

else {

   echo "IBAN NOT VALID";

} </lang>

PicoLisp

<lang Picolisp>(setq *Sizes '((GB . 22) (CH . 21) (SA . 24)))

(de iban (Str)

  (let Lst 
     (filter
        '((X) (not (sp? X))) 
        (chop (uppc Str)) )
     (when
        (= 
           (cdr (assoc (pack (head 2 Lst)) *Sizes))
           (length Lst) )
        (% 
           (format 
              (mapcar
                 '((X)
                    (if (upp? X)
                       (- (char X) 55)
                       X ) )
                 (append (nth Lst 5) (head 4 Lst)) ) )
           97 ) ) ) )

(for I '("sa03 8000 0000 6080 1016 7519"

        "CH9300762011623852957"
        "gb82west1234 56987654 32" 
        "GB82WEST000")
  (if (= 1 (iban I))
     (println 'Valid)
     (println 'Invalid) ) )

(bye)</lang>

PowerShell

<lang PowerShell> function verifIBAN ([string]$ibanS) { if ($ibanS.Length -ne 27) {return $false} else { $ibanI="$($ibanS.Substring(4,23))$($ibanS.Substring(0,4))".ToUpper() [int]$comptIBAN=0 $NumIBAN="" while ($comptIBAN -lt 27)

   {
   if ([byte]$ibanI[$comptIBAN] -ge 65 -and [byte]$ibanI[$comptIBAN] -le 90)
       {        
       $NumIban+=([byte]$ibanI[$comptIBAN]-55)
       } #pour transformer les lettres en chiffres (A=10, B=11...)
       else
       {
       $NumIban+=$ibanI[$comptIBAN]
       }
   $comptIBAN++
   }
   #cela fait un nombre de 30 chiffres : trop pour powershell, je découpe donc les 9 premiers caractères :

if ("$($NumIBAN.Substring(0,9)%97)$($NumIBAN.Substring(9,$NumIBAN.Length-9))"%97 -eq 1)

   {return $true}
   else
   {return $false}

} } #fin fonction vérification IBAN / Stéphane RABANY 2018 </lang>

Ancien texte qui ne sert à rien selon moi : I have heard that Regex should not be used with IBAN codes. Regex does seem to work, however. <lang PowerShell> @' "Country","Length","Example" "Albania",28,"AL47212110090000000235698741" "Andorra",24,"AD1200012030200359100100" "Austria",20,"AT611904300235473201" "Belgium",16,"BE68539007547034" "Bosnia and Herzegovina",20,"BA391290079401028494" "Bulgaria",22,"BG80BNBG96611020345678" "Croatia",21,"HR1210010051863000160" "Cyprus",28,"CY17002001280000001200527600" "Czech Republic",24,"CZ6508000000192000145399" "Denmark",18,"DK5000400440116243" "Estonia",20,"EE382200221020145685" "Faroe Islands",18,"FO1464600009692713" "Finland",18,"FI2112345600000785" "France",27,"FR1420041010050500013M02606" "Georgia",22,"GE29NB0000000101904917" "Germany",22,"DE89370400440532013000" "Gibraltar",23,"GI75NWBK000000007099453" "Greece",27,"GR1601101250000000012300695" "Greenland",18,"GL8964710001000206" "Hungary",28,"HU42117730161111101800000000" "Iceland",26,"IS140159260076545510730339" "Ireland",22,"IE29AIBK93115212345678" "Italy",27,"IT60X0542811101000000123456" "Kosovo",20,"XK051212012345678906" "Latvia",21,"LV80BANK0000435195001" "Liechtenstein",21,"LI21088100002324013AA" "Lithuania",20,"LT121000011101001000" "Luxembourg",20,"LU280019400644750000" "Macedonia",19,"MK07300000000042425" "Malta",31,"MT84MALT011000012345MTLCAST001S" "Moldova",24,"MD24AG000225100013104168" "Monaco",27,"MC5813488000010051108001292" "Montenegro",22,"ME25505000012345678951" "Netherlands",18,"NL91ABNA0417164300" "Norway",15,"NO9386011117947" "Poland",28,"PL27114020040000300201355387" "Portugal",25,"PT50000201231234567890154" "Romania",24,"RO49AAAA1B31007593840000" "San Marino",27,"SM86U0322509800000000270100" "Serbia",22,"RS35260005601001611379" "Slovakia",24,"SK3112000000198742637541" "Slovenia",19,"SI56191000000123438" "Spain",24,"ES9121000418450200051332" "Sweden",24,"SE3550000000054910000003" "Switzerland",21,"CH9300762011623852957" "Ukraine",29,"UA573543470006762462054925026" "United Kingdom",22,"GB29NWBK60161331926819" '@ -split "`r`n" | Set-Content -Path .\IBAN.csv -Force

$ibans = foreach ($iban in Import-Csv -Path .\IBAN.csv) {

   $iban | Select-Object -Property Country,
                                   @{Name='Code'  ; Expression={$iban.Example.Substring(0,2)}},
                                   @{Name='Length'; Expression={[int]$iban.Length}},
                                   Example

}

$ibans </lang>

Output:
Country                Code Length Example                        
-------                ---- ------ -------                        
Albania                AL       28 AL47212110090000000235698741   
Andorra                AD       24 AD1200012030200359100100       
Austria                AT       20 AT611904300235473201           
Belgium                BE       16 BE68539007547034               
Bosnia and Herzegovina BA       20 BA391290079401028494           
Bulgaria               BG       22 BG80BNBG96611020345678         
Croatia                HR       21 HR1210010051863000160          
Cyprus                 CY       28 CY17002001280000001200527600   
Czech Republic         CZ       24 CZ6508000000192000145399       
Denmark                DK       18 DK5000400440116243             
Estonia                EE       20 EE382200221020145685           
Faroe Islands          FO       18 FO1464600009692713             
Finland                FI       18 FI2112345600000785             
France                 FR       27 FR1420041010050500013M02606    
Georgia                GE       22 GE29NB0000000101904917         
Germany                DE       22 DE89370400440532013000         
Gibraltar              GI       23 GI75NWBK000000007099453        
Greece                 GR       27 GR1601101250000000012300695    
Greenland              GL       18 GL8964710001000206             
Hungary                HU       28 HU42117730161111101800000000   
Iceland                IS       26 IS140159260076545510730339     
Ireland                IE       22 IE29AIBK93115212345678         
Italy                  IT       27 IT60X0542811101000000123456    
Kosovo                 XK       20 XK051212012345678906           
Latvia                 LV       21 LV80BANK0000435195001          
Liechtenstein          LI       21 LI21088100002324013AA          
Lithuania              LT       20 LT121000011101001000           
Luxembourg             LU       20 LU280019400644750000           
Macedonia              MK       19 MK07300000000042425            
Malta                  MT       31 MT84MALT011000012345MTLCAST001S
Moldova                MD       24 MD24AG000225100013104168       
Monaco                 MC       27 MC5813488000010051108001292    
Montenegro             ME       22 ME25505000012345678951         
Netherlands            NL       18 NL91ABNA0417164300             
Norway                 NO       15 NO9386011117947                
Poland                 PL       28 PL27114020040000300201355387   
Portugal               PT       25 PT50000201231234567890154      
Romania                RO       24 RO49AAAA1B31007593840000       
San Marino             SM       27 SM86U0322509800000000270100    
Serbia                 RS       22 RS35260005601001611379         
Slovakia               SK       24 SK3112000000198742637541       
Slovenia               SI       19 SI56191000000123438            
Spain                  ES       24 ES9121000418450200051332       
Sweden                 SE       24 SE3550000000054910000003       
Switzerland            CH       21 CH9300762011623852957          
Ukraine                UA       29 UA573543470006762462054925026  
United Kingdom         GB       22 GB29NWBK60161331926819         

<lang PowerShell> $regex = [regex]'[a-zA-Z]{2}[0-9]{2}[a-zA-Z0-9]{6}[0-9]{5}([a-zA-Z0-9]?){0,16}'

foreach ($iban in $ibans) {

   [PSCustomObject]@{
       Country = $iban.Country
       Example = $iban.Example
       IsValid = $regex.IsMatch($iban.Example)
   }

} </lang>

Output:
Country                Example                         IsValid
-------                -------                         -------
Albania                AL47212110090000000235698741       True
Andorra                AD1200012030200359100100           True
Austria                AT611904300235473201               True
Belgium                BE68539007547034                   True
Bosnia and Herzegovina BA391290079401028494               True
Bulgaria               BG80BNBG96611020345678             True
Croatia                HR1210010051863000160              True
Cyprus                 CY17002001280000001200527600       True
Czech Republic         CZ6508000000192000145399           True
Denmark                DK5000400440116243                 True
Estonia                EE382200221020145685               True
Faroe Islands          FO1464600009692713                 True
Finland                FI2112345600000785                 True
France                 FR1420041010050500013M02606        True
Georgia                GE29NB0000000101904917             True
Germany                DE89370400440532013000             True
Gibraltar              GI75NWBK000000007099453            True
Greece                 GR1601101250000000012300695        True
Greenland              GL8964710001000206                 True
Hungary                HU42117730161111101800000000       True
Iceland                IS140159260076545510730339         True
Ireland                IE29AIBK93115212345678             True
Italy                  IT60X0542811101000000123456        True
Kosovo                 XK051212012345678906               True
Latvia                 LV80BANK0000435195001              True
Liechtenstein          LI21088100002324013AA              True
Lithuania              LT121000011101001000               True
Luxembourg             LU280019400644750000               True
Macedonia              MK07300000000042425                True
Malta                  MT84MALT011000012345MTLCAST001S    True
Moldova                MD24AG000225100013104168           True
Monaco                 MC5813488000010051108001292        True
Montenegro             ME25505000012345678951             True
Netherlands            NL91ABNA0417164300                 True
Norway                 NO9386011117947                    True
Poland                 PL27114020040000300201355387       True
Portugal               PT50000201231234567890154          True
Romania                RO49AAAA1B31007593840000           True
San Marino             SM86U0322509800000000270100        True
Serbia                 RS35260005601001611379             True
Slovakia               SK3112000000198742637541           True
Slovenia               SI56191000000123438                True
Spain                  ES9121000418450200051332           True
Sweden                 SE3550000000054910000003           True
Switzerland            CH9300762011623852957              True
Ukraine                UA573543470006762462054925026      True
United Kingdom         GB29NWBK60161331926819             True

PureBasic

<lang purebasic>EnableExplicit Enumeration IBAN

 #IBAN_VAL
 #IBAN_SUM
 #IBAN_NOSPACE 
 #IBAN_VAL_FORM
 #IBAN_SUM_FORM

EndEnumeration

NewMap CData.i() Macro CCD(SIGN,LENGTH)

 CData(SIGN)=LENGTH

EndMacro

Procedure.s IBANForm(iban.s,form.i)

 Define fn.s, c.i
 fn=RemoveString(UCase(iban),Chr(32))      
 If form=#IBAN_NOSPACE   :   ProcedureReturn fn  :   EndIf
 fn=Mid(fn,5)+Mid(fn,1,4)
 For c=65 To 90
   fn=ReplaceString(fn,Chr(c),Str(c-55))
 Next c
 If form=#IBAN_VAL_FORM  :   ProcedureReturn fn  :   EndIf
 fn=Left(fn,Len(fn)-2)+"00"
 If form=#IBAN_SUM_FORM  :   ProcedureReturn fn  :   EndIf

EndProcedure

Procedure.s m97iban(iban.s,calculate.i)

 Define i.i, part.s, rest.s
 Select calculate
   Case #IBAN_VAL : iban=IBANForm(iban,#IBAN_VAL_FORM)
   Case #IBAN_SUM : iban=IBANForm(iban,#IBAN_SUM_FORM)
 EndSelect  
 For i=1 To Len(iban)  ; Validierung der Prüfsumme
   part+Mid(iban,i,1)
   If Val(rest+part)<97 : Continue : EndIf
   rest=Str((Val(rest+part)) %97)  : part=""
 Next  
 Select calculate
   Case #IBAN_VAL : ProcedureReturn rest
   Case #IBAN_SUM : ProcedureReturn RSet(Str(98-Val(rest+part)),2,"0")
 EndSelect  

EndProcedure

CCD("AL",28) : CCD("AD",24) : CCD("AT",20) : CCD("AZ",28) : CCD("BE",16) : CCD("BH",22) : CCD("BA",20) CCD("BR",29) : CCD("BG",22) : CCD("CR",21) : CCD("HR",21) : CCD("CY",28) : CCD("CZ",24) : CCD("DK",18) CCD("DO",28) : CCD("EE",20) : CCD("FO",18) : CCD("FI",18) : CCD("FR",27) : CCD("GE",22) : CCD("DE",22) CCD("GI",23) : CCD("GR",27) : CCD("GL",18) : CCD("GT",28) : CCD("HU",28) : CCD("IS",26) : CCD("IE",22) CCD("IL",23) : CCD("IT",27) : CCD("KZ",20) : CCD("KW",30) : CCD("LV",21) : CCD("LB",28) : CCD("LI",21) CCD("LT",20) : CCD("LU",20) : CCD("MK",19) : CCD("MT",31) : CCD("MR",27) : CCD("MU",30) : CCD("MC",27) CCD("MD",24) : CCD("ME",22) : CCD("NL",18) : CCD("NO",15) : CCD("PK",24) : CCD("PS",29) : CCD("PL",28) CCD("PT",25) : CCD("RO",24) : CCD("SM",27) : CCD("SA",24) : CCD("RS",22) : CCD("SK",24) : CCD("SI",19) CCD("ES",24) : CCD("SE",24) : CCD("CH",21) : CCD("TN",24) : CCD("TR",26) : CCD("AE",23) : CCD("GB",22) CCD("VG",24)

DataSection

 IBANData:
 Data.s "GB82 WEST 1234 5698 7654 32"
 Data.s "GB82WEST12345698765432"
 Data.s "gb82 west 1234 5698 7654 32"
 Data.s "GB82 TEST 1234 5698 7654 32"
 Data.s "GR16 0110 1250 0000 0001 2300 695"
 Data.s "GB29 NWBK 6016 1331 9268 19"
 Data.s "SA03 8000 0000 6080 1016 7519"
 Data.s "CH93 0076 2011 6238 5295 7"
 Data.s "IL62 0108 0000 0009 9999 999"
 Data.s "IL62-0108-0000-0009-9999-999"
 Data.s "US12 3456 7890 0987 6543 210"
 Data.s "GR16 0110 1250 0000 0001 2300 695X"
 Data.s Chr(0)

EndDataSection

Define iban.s, cc.s OpenConsole() Restore IBANData Repeat

 Read.s iban : If iban=Chr(0) : Break : EndIf
 Print("IBAN"+#TAB$+": "+LSet(iban,35,Chr(32))+#TAB$)
 cc=Left(IBANForm(iban,#IBAN_NOSPACE),2)
 If CData(cc) 
   If Not CData()=Len(IBANForm(iban,#IBAN_NOSPACE)) : PrintN("[INCORRECT: LENGTH]") : Continue : EndIf
 Else
   PrintN("[INCORRECT: COUNTRY]") : Continue
 EndIf
 If Not Val(m97iban(iban,#IBAN_VAL))=1 : PrintN("[INCORRECT: MOD97]") : Continue : EndIf
 If Not Right(IBANForm(iban,#IBAN_VAL_FORM),2)=m97iban(iban,#IBAN_SUM)
   PrintN("[INCORRECT: CHECKSUM]") : Continue
 EndIf
 PrintN("[CORRECT]")  

ForEver Input() End</lang>

Output:
IBAN    : GB82 WEST 1234 5698 7654 32           [CORRECT]
IBAN    : GB82WEST12345698765432                [CORRECT]
IBAN    : gb82 west 1234 5698 7654 32           [CORRECT]
IBAN    : GB82 TEST 1234 5698 7654 32           [INCORRECT: MOD97]
IBAN    : GR16 0110 1250 0000 0001 2300 695     [CORRECT]
IBAN    : GB29 NWBK 6016 1331 9268 19           [CORRECT]
IBAN    : SA03 8000 0000 6080 1016 7519         [CORRECT]
IBAN    : CH93 0076 2011 6238 5295 7            [CORRECT]
IBAN    : IL62 0108 0000 0009 9999 999          [CORRECT]
IBAN    : IL62-0108-0000-0009-9999-999          [INCORRECT: LENGTH]
IBAN    : US12 3456 7890 0987 6543 210          [INCORRECT: COUNTRY]
IBAN    : GR16 0110 1250 0000 0001 2300 695X    [INCORRECT: LENGTH]

Python

Translation of: Ruby

<lang python>import re

_country2length = dict(

   AL=28, AD=24, AT=20, AZ=28, BE=16, BH=22, BA=20, BR=29,
   BG=22, CR=21, HR=21, CY=28, CZ=24, DK=18, DO=28, EE=20,
   FO=18, FI=18, FR=27, GE=22, DE=22, GI=23, GR=27, GL=18,
   GT=28, HU=28, IS=26, IE=22, IL=23, IT=27, KZ=20, KW=30,
   LV=21, LB=28, LI=21, LT=20, LU=20, MK=19, MT=31, MR=27,
   MU=30, MC=27, MD=24, ME=22, NL=18, NO=15, PK=24, PS=29,
   PL=28, PT=25, RO=24, SM=27, SA=24, RS=22, SK=24, SI=19,
   ES=24, SE=24, CH=21, TN=24, TR=26, AE=23, GB=22, VG=24 )

def valid_iban(iban):

   # Ensure upper alphanumeric input.
   iban = iban.replace(' ',).replace('\t',)
   if not re.match(r'^[\dA-Z]+$', iban): 
       return False
   # Validate country code against expected length.
   if len(iban) != _country2length[iban[:2]]:
       return False
   # Shift and convert.
   iban = iban[4:] + iban[:4]
   digits = int(.join(str(int(ch, 36)) for ch in iban)) #BASE 36: 0..9,A..Z -> 0..35
   return digits % 97 == 1

if __name__ == '__main__':

   for account in ["GB82 WEST 1234 5698 7654 32", "GB82 TEST 1234 5698 7654 32"]:

print('%s validation is: %s' % (account, valid_iban(account)))</lang>

Output:
GB82 WEST 1234 5698 7654 32 validation is: True
GB82 TEST 1234 5698 7654 32 validation is: False

Racket

<lang racket>#lang racket (define lens

 '([AL 28] [AD 24] [AT 20] [AZ 28] [BH 22] [BE 16] [BA 20] [BR 29] [BG 22]
   [CR 21] [HR 21] [CY 28] [CZ 24] [DK 18] [DO 28] [EE 20] [FO 18] [FI 18]
   [FR 27] [GE 22] [DE 22] [GI 23] [GR 27] [GL 18] [GT 28] [HU 28] [IS 26]
   [IE 22] [IL 23] [IT 27] [KZ 20] [KW 30] [LV 21] [LB 28] [LI 21] [LT 20]
   [LU 20] [MK 19] [MT 31] [MR 27] [MU 30] [MC 27] [MD 24] [ME 22] [NL 18]
   [NO 15] [PK 24] [PS 29] [PL 28] [PT 25] [RO 24] [SM 27] [SA 24] [RS 22]
   [SK 24] [SI 19] [ES 24] [SE 24] [CH 21] [TN 24] [TR 26] [AE 23] [GB 22]
   [VG 24]))

(define (valid-iban? str)

 (define str* (regexp-replace* #px"\\s+" str ""))
 (define c (cond [(regexp-match #rx"^[A-Z][A-Z]" str*)
                  => (λ(x) (assq (string->symbol (car x)) lens))]
                 [else #f]))
 (define (letter c)
   (number->string (+ (char->integer (string-ref c 0)) -65 10)))
 (and c (= (cadr c) (string-length str*))
      (regexp-match? #rx"[A-Z0-9]" str*)
      (let* ([x (string-append (substring str* 4) (substring str* 0 4))]
             [x (string->number (regexp-replace* #rx"[A-Z]" x letter))])
        (= 1 (modulo x 97)))))

(valid-iban? "GB82 WEST 1234 5698 7654 32") ; => #t (valid-iban? "GB82 TEST 1234 5698 7654 32") ; => #f</lang>

REXX

These REXX programs can validate an IBAN specified on the command line or from an internal list.

basic checking

<lang rexx>/*REXX program validates an IBAN (International Bank Account Number). */ @.=; @.1 = 'GB82 WEST 1234 5698 7654 32 '

                @.2  =  'Gb82 West 1234 5698 7654 32        '
                @.3  =  'GB82 TEST 1234 5698 7654 32        '
                @.4  =  'GR16 0110 1250 0000 0001 2300 695  '
                @.5  =  'GB29 NWBK 6016 1331 9268 19        '
                @.6  =  'SA03 8000 0000 6080 1016 7519      '
                @.7  =  'CH93 0076 2011 6238 5295 7         '
                @.8  =  'IL62 0108 0000 0009 9999 999       '
                @.9  =  'IL62-0108-0000-0009-9999-999       '
                @.10 =  'US12 3456 7890 0987 6543 210       '
                @.11 =  'GR16 0110 1250 0000 0001 2300 695X '

parse arg @.0 /*get optional 1st arg from CL*/

                do k=0 + (arg()==0)  while @.k\==      /*either:   0  or  1  ──►  n  */
                r = val_IBAN(@.k)
                if r==0  then say '  valid IBAN:'    @.k
                         else say 'invalid IBAN:'    @.k      "  "      r
                if k==0  then leave             /*User specified IBAN?  Then we're done*/
                end   /*k*/

exit /*stick a fork in it, we're all done. */ /*──────────────────────────────────────────────────────────────────────────────────────*/ val_IBAN: procedure; arg x; numeric digits 200 /*allow for big numbers in the IBAN's. */ x=space(x,0); L=length(x) /*elide blanks; determine the length. */ cc= 'AD 24 AE 23 AL 28 AT 20 AZ 28 BA 20 BE 16 BG 22 BH 22 BR 29 CH 21 CR 21 CY 28 CZ 24',

   'DE 22 DK 18 DO 28 EE 20 ES 24 FI 18 FO 18 FR 27 GB 22 GE 22 GI 23 GL 18 GR 27 GT 28',
   'HR 21 HU 28 IE 22 IL 23 IS 26 IT 27 KW 30 KZ 20 LB 28 LI 21 LT 20 LU 20 LV 21 MC 27',
   'MD 24 ME 22 MK 19 MR 27 MT 31 MU 30 NL 18 NO 15 PK 24 PL 28 PS 29 PT 25 RO 24 RS 22',
   'SA 24 SE 24 SI 19 SK 24 SM 27 TN 24 TR 26 VG 24'      /*a list of valid countries. */

@ABC# = 'ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789' /*the Latin alphabet and decimal digits*/ cc_=left(x, 2); kk=substr(x, 3, 2) /*get IBAN country code and checkDigits*/ c#=wordpos(cc_, cc) /*find the country code index. */ cL=word(cc, c# + 1) /*get the length of the country's IBAN.*/ e= '***error*** invalid IBAN' /*literal used when displaying an error*/ if c#==0 then return e 'country code:' cc_ if \datatype(x, 'A') then return e 'character:' substr(x, verify(x, @ABC#), 1) if cL\==L then return e 'length:' L ' (should be' cL")" y=substr(x, 5)left(x, 4) /*put four digs in front ───► the back.*/ z= /* [↓] translate characters ──► digits*/

    do j=1  for L;      _=substr(y, j, 1)
    if datatype(_, 'U')  then z=z || pos(_, @ABC#) + 9        /*if uppercase, then ··· */
                         else z=z || _
    end   /*j*/

if z//97==1 then return 0 /*check if correct remainder (modulus).*/

                 return e   'check digits.'</lang>
output   when using the default input:
  valid IBAN: GB82 WEST 1234 5698 7654 32
  valid IBAN: Gb82 West 1234 5698 7654 32
invalid IBAN: GB82 TEST 1234 5698 7654 32            ***error***  invalid check digits.
  valid IBAN: GR16 0110 1250 0000 0001 2300 695
  valid IBAN: GB29 NWBK 6016 1331 9268 19
  valid IBAN: SA03 8000 0000 6080 1016 7519
  valid IBAN: CH93 0076 2011 6238 5295 7
  valid IBAN: IL62 0108 0000 0009 9999 999
invalid IBAN: IL62-0108-0000-0009-9999-999           ***error***  invalid IBAN character: -
invalid IBAN: US12 3456 7890 0987 6543 210           ***error***  invalid IBAN country code: US
invalid IBAN: GR16 0110 1250 0000 0001 2300 695X     ***error***  invalid IBAN length: 28  (should be 27)

more checking

This version of the REXX program has more error checking:

  • checks for two countries that may not be valid (as per their entry date into the IBAN system)
  • checks some countries to make sure their check digits match a specific value

<lang rexx>/*REXX pgm validates an IBAN (International Bank Account Number), including date ranges.*/ @.=; @.1 = 'GB82 WEST 1234 5698 7654 32 '

                @.2  =  'Gb82 West 1234 5698 7654 32        '
                @.3  =  'GB82 TEST 1234 5698 7654 32        '
                @.4  =  'GR16 0110 1250 0000 0001 2300 695  '
                @.5  =  'GB29 NWBK 6016 1331 9268 19        '
                @.6  =  'SA03 8000 0000 6080 1016 7519      '
                @.7  =  'CH93 0076 2011 6238 5295 7         '
                @.8  =  'IL62 0108 0000 0009 9999 999       '
                @.9  =  'IL62-0108-0000-0009-9999-999       '
                @.10 =  'US12 3456 7890 0987 6543 210       '
                @.11 =  'GR16 0110 1250 0000 0001 2300 695X '
                @.12 =  'GT11 2222 3333 4444 5555 6666 7777 '
                @.13 =  'MK11 2222 3333 4444 555            '

parse arg @.0 /*get optional 1st arg from CL*/

                do k=0 + (arg()==0)  while @.k\==      /*either:   0  or  1  ──►  n  */
                r = val_IBAN(@.k)
                if r==0  then say '  valid IBAN:'    @.k
                         else say 'invalid IBAN:'    @.k      "  "      r
                if k==0  then leave             /*User specified IBAN?  Then we're done*/
                end   /*k*/

exit /*stick a fork in it, we're all done. */ /*──────────────────────────────────────────────────────────────────────────────────────*/ val_IBAN: procedure; arg x; numeric digits 200 /*allow for big numbers in the IBAN's. */ x=space(x,0); L=length(x) /*elide blanks; determine the length. */ cc= 'AD 24 AE 23 AL 28 AT 20 AZ 28 BA 20 BE 16 BG 22 BH 22 BR 29 CH 21 CR 21 CY 28 CZ 24',

   'DE 22 DK 18 DO 28 EE 20 ES 24 FI 18 FO 18 FR 27 GB 22 GE 22 GI 23 GL 18 GR 27 GT 28',
   'HR 21 HU 28 IE 22 IL 23 IS 26 IT 27 KW 30 KZ 20 LB 28 LI 21 LT 20 LU 20 LV 21 MC 27',
   'MD 24 ME 22 MK 19 MR 27 MT 31 MU 30 NL 18 NO 15 PK 24 PL 28 PS 29 PT 25 RO 24 RS 22',
   'SA 24 SE 24 SI 19 SK 24 SM 27 TN 24 TR 26 VG 24'      /*a list of valid countries. */

@ABC# = 'ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789' /*the Latin alphabet and decimal digits*/ cc_=left(x, 2); kk=substr(x, 3, 2) /*get IBAN country code and checkDigits*/ c#=wordpos(cc_, cc) /*find the country code index. */ cL=word(cc, c# + 1) /*get the length of the country's IBAN.*/ e= '***error*** invalid IBAN' /*literal used when displaying an error*/ if c#==0 then return e 'country code:' cc_ if \datatype(x, 'A') then return e 'character:' substr(x, verify(x, @ABC#), 1) if cL\==L then return e 'length:' L ' (should be' cL")" if cc_=='BR' & date("S")<20130701 then return e "country, Brazil isn't valid until 1-July-2013." if cc_=='GT' & date("S")<20140701 then return e "country, Guatemala isn't valid until 1-July-2014." if cc_=='BA' & kk\==39 then return e "check digits for Bosnia and Herzegovina:" kk if cc_=='MK' & kk\==07 then return e "check digits for Macedonia:" kk if cc_=='ME' & kk\==25 then return e "check digits for Montenegro:" kk if cc_=='PT' & kk\==50 then return e "check digits for Portugal:" kk if cc_=='SI' & kk\==56 then return e "check digits for Slovenia:" kk y=substr(x, 5)left(x, 4) /*put four digs in front ───► the back.*/ z= /* [↓] translate characters ──► digits*/

    do j=1  for L;      _=substr(y, j, 1)
    if datatype(_, 'U')  then z=z || pos(_, @ABC#) + 9        /*if uppercase, then ··· */
                         else z=z || _
    end   /*j*/

if z//97==1 then return 0 /*check if correct remainder (modulus).*/

                 return e    'check digits.'</lang>
output   when using the default input,   (the run date of this program is   29-April-2013):
  valid IBAN: GB82 WEST 1234 5698 7654 32
  valid IBAN: Gb82 West 1234 5698 7654 32
invalid IBAN: GB82 TEST 1234 5698 7654 32            ***error***  invalid IBAN check digits.
  valid IBAN: GR16 0110 1250 0000 0001 2300 695
  valid IBAN: GB29 NWBK 6016 1331 9268 19
  valid IBAN: SA03 8000 0000 6080 1016 7519
  valid IBAN: CH93 0076 2011 6238 5295 7
  valid IBAN: IL62 0108 0000 0009 9999 999
invalid IBAN: IL62-0108-0000-0009-9999-999           ***error***  invalid IBAN character: -
invalid IBAN: US12 3456 7890 0987 6543 210           ***error***  invalid IBAN country code: US
invalid IBAN: GR16 0110 1250 0000 0001 2300 695X     ***error***  invalid IBAN length: 28  (should be 27)
invalid IBAN: GT11 2222 3333 4444 5555 6666 7777     ***error***  invalid IBAN country, Guatemala isn't valid until 1-July-2014.
invalid IBAN: MK11 2222 3333 4444 555                ***error***  invalid IBAN check digits for Macedonia: 11

Ring

<lang ring>

  1. Project : IBAN

codes = list(5) codes[1] = "GB82 WEST 1234 5698 7654 32" codes[2] = "GB82 TEST 1234 5698 7654 32" codes[3] = "GB81 WEST 1234 5698 7654 32" codes[4] = "SA03 8000 0000 6080 1016 7519" codes[5] = "CH93 0076 2011 6238 5295 7"

for y = 1 to len(codes)

     see codes[y]
     flag = 1
     codes[y] = substr(codes[y], " ", "")
     checkcode(codes[y])
     check = checkiban(codes[y])
     if check = 1
        see " is valid" + nl
     else
        see " is invalid" + nl
     ok

next

func checkcode(code)

       for n = 1 to 2
             if ascii(code[n]) < 65 or ascii(code[n]) > 90
                flag = 0
             ok
       next
       for m = 3 to len(code)
             if (ascii(code[m]) > 64 and ascii(code[m]) < 91) or (ascii(code[m]) > 47 and ascii(code[m]) < 58)
             else
                 flag = 0
             ok
       next

func checkiban(code)

       code= substr(code, 5, len(code) - 4) + left(code, 4)
       for x = 1 to len(code)
             if ascii(code[x]) > 64 and ascii(code[x]) < 91
                code = left(code, x-1) + string(ascii(code[x]) - 55) + right(code, len(code) - x)
             ok
       next
       modold = left(code,9) % 97
       for p = 1 to floor((len(code)-9)/7)
             modnew = string(modold) + substr(code, 10 + (p-1) * 7, 7)
             modnew = number(modnew) % 97
             modold = modnew
       next
       modrest = right(code, len(code) - ((p-1)*7 + 9))
       modnew = string(modold) + modrest
       modnew = number(modnew) % 97
       return modnew

</lang> Output:

GB82 WEST 1234 5698 7654 32 is valid
GB82 TEST 1234 5698 7654 32 is invalid
GB81 WEST 1234 5698 7654 32 is invalid
SA03 8000 0000 6080 1016 7519 is valid
CH93 0076 2011 6238 5295 7 is valid

Ruby

Works with: Ruby version 1.9+

<lang Ruby>def valid_iban? iban

 len = {
   AL: 28, AD: 24, AT: 20, AZ: 28, BE: 16, BH: 22, BA: 20, BR: 29,
   BG: 22, CR: 21, HR: 21, CY: 28, CZ: 24, DK: 18, DO: 28, EE: 20,
   FO: 18, FI: 18, FR: 27, GE: 22, DE: 22, GI: 23, GR: 27, GL: 18,
   GT: 28, HU: 28, IS: 26, IE: 22, IL: 23, IT: 27, KZ: 20, KW: 30,
   LV: 21, LB: 28, LI: 21, LT: 20, LU: 20, MK: 19, MT: 31, MR: 27,
   MU: 30, MC: 27, MD: 24, ME: 22, NL: 18, NO: 15, PK: 24, PS: 29,
   PL: 28, PT: 25, RO: 24, SM: 27, SA: 24, RS: 22, SK: 24, SI: 19,
   ES: 24, SE: 24, CH: 21, TN: 24, TR: 26, AE: 23, GB: 22, VG: 24
 }
 # Ensure upper alphanumeric input.
 iban.delete! " \t"
 return false unless iban =~ /^[\dA-Z]+$/
 # Validate country code against expected length.
 cc = iban[0, 2].to_sym
 return false unless iban.size == len[cc]
 # Shift and convert.
 iban = iban[4..-1] + iban[0, 4]
 iban.gsub!(/./) { |c| c.to_i(36) }
 iban.to_i % 97 == 1

end

p valid_iban? "GB82 WEST 1234 5698 7654 32" #=> true p valid_iban? "GB82 TEST 1234 5698 7654 32" #=> false</lang>

Rust

<lang Rust> fn main() {

   for iban in [
       "",
       "x",
       "QQ82",
       "QQ82W",
       "GB82 TEST 1234 5698 7654 322",
       "gb82 WEST 1234 5698 7654 32",
       "GB82 WEST 1234 5698 7654 32",
       "GB82 TEST 1234 5698 7654 32",
       "GB81 WEST 1234 5698 7654 32",
       "SA03 8000 0000 6080 1016 7519",
       "CH93 0076 2011 6238 5295 7",
   ].iter()
   {
       println!(
           "'{}' is {}valid",
           iban,
           if validate_iban(iban) { "" } else { "NOT " }
       );
   }

}

fn validate_iban(iban: &str) -> bool {

   let iso_len = [
       ("AL", 28), ("AD", 24), ("AT", 20), ("AZ", 28), ("BE", 16), ("BH", 22),
       ("BA", 20), ("BR", 29), ("BG", 22), ("HR", 21), ("CY", 28), ("CZ", 24),
       ("DK", 18), ("DO", 28), ("EE", 20), ("FO", 18), ("FI", 18), ("FR", 27),
       ("GE", 22), ("DE", 22), ("GI", 23), ("GL", 18), ("GT", 28), ("HU", 28),
       ("IS", 26), ("IE", 22), ("IL", 23), ("IT", 27), ("KZ", 20), ("KW", 30),
       ("LV", 21), ("LB", 28), ("LI", 21), ("LT", 20), ("LU", 20), ("MK", 19),
       ("MT", 31), ("MR", 27), ("MU", 30), ("MC", 27), ("MD", 24), ("ME", 22),
       ("NL", 18), ("NO", 15), ("PK", 24), ("PS", 29), ("PL", 28), ("PT", 25),
       ("RO", 24), ("SM", 27), ("SA", 24), ("RS", 22), ("SK", 24), ("SI", 19),
       ("ES", 24), ("SE", 24), ("CH", 21), ("TN", 24), ("TR", 26), ("AE", 23),
       ("GB", 22), ("VG", 24), ("GR", 27), ("CR", 21),
   ];
   let trimmed_iban = iban.chars()
       .filter(|&ch| ch != ' ')
       .collect::<String>()
       .to_uppercase();
   if trimmed_iban.len() < 4 {
       return false;
   }
   let prefix = &trimmed_iban[0..2];
   if let Some(pair) = iso_len.iter().find(|&&(code, _)| code == prefix) {
       if pair.1 != trimmed_iban.len() {
           return false;
       }
   } else {
       return false;
   }
   let reversed_iban = format!("{}{}", &trimmed_iban[4..], &trimmed_iban[0..4]);
   let mut expanded_iban = String::new();
   for ch in reversed_iban.chars() {
       expanded_iban.push_str(&if ch.is_numeric() {
           format!("{}", ch)
       } else {
           format!("{}", ch as u8 - 'A' as u8 + 10u8)
       });
   }
   expanded_iban.bytes().fold(0, |acc, ch| {
       (acc * 10 + ch as u32 - '0' as u32) % 97
   }) == 1

} </lang>

Scala

Library: Scala

<lang Scala>import scala.collection.immutable.SortedMap

class Iban(val iban: String) {

 // Isolated tests
 def isAllUpperCase = iban.toUpperCase == iban
 def isValidpattern = (Iban.pattern findFirstIn iban).nonEmpty
 def isNationalSize = {
   Iban.ccVsLength.getOrElse(iban.take(2), 0) == iban.size
 }
 def isCheckNumberOK = {
   def rearrange = (iban.drop(4) + iban.take(4)). // Move left country code part to end
     // continue with each char converted to Int
     map(ch => if (ch.isDigit) ch.toInt - '0' else ch - 'A' + 10).mkString
   (BigInt(rearrange) mod 97) == 1
 }
 def isValidIban = {
   isAllUpperCase &&
     isValidpattern &&
     isNationalSize &&
     isCheckNumberOK
 }

}

object Iban {

 // IBAN length database
 lazy val ccVsLength: SortedMap[String, Int] = SortedMap[String, Int]() ++
   """AD24 AE23 AL28 AO25 AT20 AZ28 BA20 BE16 BF27 BG22 BH22 BI16
     |BJ28 BR29 CG27 CH21 CI28 CM27 CR21 CV25 CY28 CZ24 DE22 DK18
     |DO28 DZ24 EE20 EG27 ES24 FI18 FO18 FR27 GA27 GB22 GE22 GI23
     |GL18 GR27 GT28 HR21 HU28 IE22 IL23 IR26 IS26 IT27 JO30 KW30
     |KZ20 LB28 LI21 LT20 LU20 LV21 MC27 MD24 ME22 MG27 MK19 ML28
     |MR27 MT31 MU30 MZ25 NL18 NO15 PK24 PL28 PS29 PT25 QA29 RO24
     |RS22 SA24 SE24 SI19 SK24 SM27 SN28 TN24 TR26 UA29 VG24""".
     stripMargin.replaceAll( """\s""", " ").split(' ').
     map(v => (v.take(2), if (v.isEmpty) 0 else v.slice(2, 4).toInt))
 lazy val pattern = "([A-Z]{2})([0-9]{2})([A-Z0-9]{4})([A-Z0-9]{0,2})([0-9]{7})(([A-Z0-9]?){0,16})".r
 def apply(s: String) = new Iban(s.replaceAll( """\s""", ""))

}</lang>The test program: <lang Scala>object IbanTest extends App {

 def blackCases = """AT611904300235473201
                    |GB82TEST12345698765432
                    |GB81WEST12345698765432""".stripMargin
 def whiteCases = """AD1200012030200359100100
                    |AE26 0211 0000 0023 0064 016
                    |AL47 2121 1009 0000 0002 3569 8741
                    |AO06000600000100037131174
                    |AZ21NABZ00000000137010001944
                    |BA391290079401028494
                    |BE68539007547034
                    |BF1030134020015400945000643
                    |BG80BNBG96611020345678
                    |BH29BMAG1299123456BH00
                    |BI43201011067444
                    |BJ11B00610100400271101192591
                    |BR9700360305000010009795493P1
                    |CG5230011000202151234567890
                    |CH9300762011623852957
                    |CI05A00060174100178530011852
                    |CM2110003001000500000605306
                    |CR0515202001026284066
                    |CV64000300004547069110176
                    |CY17002001280000001200527600
                    |CZ6508000000192000145399
                    |DE89370400440532013000
                    |DK5000400440116243
                    |DO28BAGR00000001212453611324
                    |DZ4000400174401001050486
                    |EE382200221020145685
                    |EG1100006001880800100014553
                    |ES9121000418450200051332
                    |FI2112345600000785
                    |FO1464600009692713
                    |FR1420041010050500013M02606
                    |FR7630007000110009970004942
                    |GA2140002000055602673300064
                    |GB29NWBK60161331926819
                    |GE29NB0000000101904917
                    |GI75NWBK000000007099453
                    |GL8964710001000206
                    |GR1601101250000000012300695
                    |GT82TRAJ01020000001210029690
                    |HR1210010051863000160
                    |HU42117730161111101800000000
                    |IE29AIBK93115212345678
                    |IL620108000000099999999
                    |IR580540105180021273113007
                    |IS140159260076545510730339
                    |IT60X0542811101000000123456
                    |JO94CBJO0010000000000131000302
                    |KW74NBOK0000000000001000372151
                    |KZ176010251000042993
                    |LB30099900000001001925579115
                    |LI21088100002324013AA
                    |LT121000011101001000
                    |LU280019400644750000
                    |LV80BANK0000435195001
                    |MC5813488000010051108001292
                    |MD24AG000225100013104168
                    |ME25505000012345678951
                    |MG4600005030010101914016056
                    |MK07300000000042425
                    |ML03D00890170001002120000447
                    |MR1300012000010000002037372
                    |MT84MALT011000012345MTLCAST001S
                    |MU17BOMM0101101030300200000MUR
                    |MZ59000100000011834194157
                    |NL91ABNA0417164300
                    |NL81 TRIO 0212 4710 66
                    |NO9386011117947
                    |PK24SCBL0000001171495101
                    |PL27114020040000300201355387
                    |PS92PALS000000000400123456702
                    |PT50000200000163099310355
                    |PT50000201231234567890154
                    |QA58 DOHB 0000 1234 5678 90AB CDEF G
                    |RO49 AAAA 1B31 0075 9384 0000
                    |RS35260005601001611379
                    |SA0380000000608010167519
                    |SE3550000000054910000003
                    |SI56191000000123438
                    |SK3112000000198742637541
                    |SM86U0322509800000000270100
                    |SN12K00100152000025690007542
                    |TN5914207207100707129648
                    |TR330006100519786457841326
                    |UA57 3543 4700 0676 2462 0549 2502 6
                    |VG96 VPVG 0000 0123 4567 8901
                    |GB82 WEST 1234 5698 7654 32
                    |SA03 8000 0000 6080 1016 7519
                    |CH93 0076 2011 6238 5295 7""".stripMargin
 whiteCases.lines.foreach(l => assert(Iban(l).isValidIban))
 blackCases.lines.foreach(l => assert(!Iban(l).isValidIban))
 println(s"Successfully completed; ${whiteCases.lines.size + blackCases.lines.size} cases tested, no errors.")

}</lang>

Output:
Successfully completed; 91 cases tested, no errors.

Seed7

<lang seed7>$ include "seed7_05.s7i";

 include "bigint.s7i";

const type: countryHash is hash [string] integer;

const func countryHash: initCountryCode is func

 result
   var countryHash: cc is countryHash.value;
 begin
   cc @:= ["AL"] 28; cc @:= ["AD"] 24; cc @:= ["AT"] 20; cc @:= ["AZ"] 28; cc @:= ["BE"] 16; cc @:= ["BH"] 22;
   cc @:= ["BA"] 20; cc @:= ["BR"] 29; cc @:= ["BG"] 22; cc @:= ["CR"] 21; cc @:= ["HR"] 21; cc @:= ["CY"] 28;
   cc @:= ["CZ"] 24; cc @:= ["DK"] 18; cc @:= ["DO"] 28; cc @:= ["EE"] 20; cc @:= ["FO"] 18; cc @:= ["FI"] 18;
   cc @:= ["FR"] 27; cc @:= ["GE"] 22; cc @:= ["DE"] 22; cc @:= ["GI"] 23; cc @:= ["GR"] 27; cc @:= ["GL"] 18;
   cc @:= ["GT"] 28; cc @:= ["HU"] 28; cc @:= ["IS"] 26; cc @:= ["IE"] 22; cc @:= ["IL"] 23; cc @:= ["IT"] 27;
   cc @:= ["KZ"] 20; cc @:= ["KW"] 30; cc @:= ["LV"] 21; cc @:= ["LB"] 28; cc @:= ["LI"] 21; cc @:= ["LT"] 20;
   cc @:= ["LU"] 20; cc @:= ["MK"] 19; cc @:= ["MT"] 31; cc @:= ["MR"] 27; cc @:= ["MU"] 30; cc @:= ["MC"] 27;
   cc @:= ["MD"] 24; cc @:= ["ME"] 22; cc @:= ["NL"] 18; cc @:= ["NO"] 15; cc @:= ["PK"] 24; cc @:= ["PS"] 29;
   cc @:= ["PL"] 28; cc @:= ["PT"] 25; cc @:= ["RO"] 24; cc @:= ["SM"] 27; cc @:= ["SA"] 24; cc @:= ["RS"] 22;
   cc @:= ["SK"] 24; cc @:= ["SI"] 19; cc @:= ["ES"] 24; cc @:= ["SE"] 24; cc @:= ["CH"] 21; cc @:= ["TN"] 24;
   cc @:= ["TR"] 26; cc @:= ["AE"] 23; cc @:= ["GB"] 22; cc @:= ["VG"] 24;
 end func;

const countryHash: countryCode is initCountryCode;

const func boolean: isLegal (in var string: iban) is func

 result
   var boolean: legal is FALSE;
 local
   var char: ch is ' ';
   var string: converted is "";
 begin
   iban := upper(replace(iban, " ", ""));
   legal := iban[.. 2] in countryCode and countryCode[iban[.. 2]] = length(iban);
   iban := iban[5 ..] & iban[.. 4];
   for ch range iban do
     case ch of
       when {'0' .. '9'}: converted &:= ch;
       when {'A' .. 'Z'}: converted &:= str(ord(ch) - ord('A') + 10);
       otherwise: legal := FALSE;
     end case;
   end for;
   legal := legal and (bigInteger parse converted) rem 97_ = 1_;
 end func;

const proc: check (in string: iban) is func

 begin
   writeln("Valid " <& iban <& ": " <& isLegal(iban));
 end func;

const proc: main is func

 begin
   check("GB82 WEST 1234 5698 7654 32");
   check("GB82WEST12345698765432");
   check("gb82 west 1234 5698 7654 32");
   check("GB82 TEST 1234 5698 7654 32");
   check("GB82 WEST 1243 5698 7654 32");
 end func;</lang>
Output:
Valid GB82 WEST 1234 5698 7654 32: TRUE
Valid GB82WEST12345698765432: TRUE
Valid gb82 west 1234 5698 7654 32: TRUE
Valid GB82 TEST 1234 5698 7654 32: FALSE
Valid GB82 WEST 1243 5698 7654 32: FALSE

Sidef

<lang ruby>func valid_iban(iban) {

 static len = Hash(
   AD=>24, AE=>23, AL=>28, AO=>25, AT=>20, AZ=>28, BA=>20, BE=>16, BF=>27,
   BG=>22, BH=>22, BI=>16, BJ=>28, BR=>29, CG=>27, CH=>21, CI=>28, CM=>27,
   CR=>21, CV=>25, CY=>28, CZ=>24, DE=>22, DK=>18, DO=>28, DZ=>24, EE=>20,
   EG=>27, ES=>24, FI=>18, FO=>18, FR=>27, GA=>27, GB=>22, GE=>22, GI=>23,
   GL=>18, GR=>27, GT=>28, HR=>21, HU=>28, IE=>22, IL=>23, IR=>26, IS=>26,
   IT=>27, JO=>30, KW=>30, KZ=>20, LB=>28, LI=>21, LT=>20, LU=>20, LV=>21,
   MC=>27, MD=>24, ME=>22, MG=>27, MK=>19, ML=>28, MR=>27, MT=>31, MU=>30,
   MZ=>25, NL=>18, NO=>15, PK=>24, PL=>28, PS=>29, PT=>25, QA=>29, RO=>24,
   RS=>22, SA=>24, SE=>24, SI=>19, SK=>24, SM=>27, SN=>28, TN=>24, TR=>26,
   UA=>29, VG=>24,
 )
 # Ensure upper alphanumeric input.
 iban -= /\s+/g
 iban.uc! ~~ /^[0-9A-Z]+\z/ || return false
 # Validate country code against expected length.
 var cc = iban.substr(0, 2)
 iban.len == len{cc} || return false
 # Shift and convert.
 iban.sub!(/(.{4})(.+)/, {|a,b| b+a})
 iban.gsub!(/([A-Z])/,   {|a| a.ord - 55})
 iban.to_i % 97 == 1

}

say valid_iban("GB82 WEST 1234 5698 7654 32") #=> true say valid_iban("GB82 TEST 1234 5698 7654 32") #=> false</lang>

SNOBOL4

<lang SNOBOL4>* IBAN - International Bank Account Number validation

     DEFINE('ibantable()')                           :(iban_table_end)

ibantable

     ibantable = TABLE(70)
     ibancodes =

+ 'AL28AD24AT20AZ28BE16BH22BA20BR29BG22CR21' + 'HR21CY28CZ24DK18DO28EE20FO18FI18FR27GE22' + 'DE22GI23GR27GL18GT28HU28IS26IE22IL23IT27' + 'KZ20KW30LV21LB28LI21LT20LU20MK19MT31MR27' + 'MU30MC27MD24ME22NL18NO15PK24PS29PL28PT25' + 'RO24SM27SA24RS22SK24SI19ES24SE24CH21TN24' + 'TR26AE23GB22VG24'

     nordeacodes =

+ 'DZ24AO25BJ28FB27BI16CM27CV25IR26CI28MG27' + 'ML28MZ25SN28UA29'

     allcodes = ibancodes nordeacodes

iban1 allcodes LEN(2) . country LEN(2) . length = :F(return)

     ibantable<country> = length                     :(iban1)

iban_table_end

     DEFINE('tonumbers(tonumbers)letter,p')          :(tonumbers_end)

tonumbers

     tonumbers ANY(&UCASE) . letter                  :f(RETURN)
     &UCASE @p letter
     tonumbers letter = p + 10                       :(tonumbers)

tonumbers_end

  • modulo for long integers
     DEFINE('mod(m,n)')                              :(mod_end)

mod m LEN(9) . r = :f(modresult)

     mod = REMDR(CONVERT(r,"INTEGER"), n)

mod0 m LEN(7) . r = :f(modresult)

     mod = mod r
     mod = REMDR(mod, n)                             :(mod0)

modresult

     mod = GT(SIZE(m), 0) REMDR(mod m, n)            :(RETURN)

mod_end

     DEFINE('invalid(l,t)')                          :(invalid_end)

invalid

     OUTPUT = "Invalid IBAN: " l ": " t              :(RETURN)

invalid_end

          • main *****
     ibant  = ibantable()
     FREEZE(ibant)
     INPUT(.INPUT, 28,,'iban.dat') 

read line = INPUT :f(END)

     country = checkdigits = line2 =
    • GB82 WEST 1234 5698 7654 32
    • Uppercase line2 and remove spaces.
     line2 = REPLACE(line, &LCASE, &UCASE)

space line2 ANY(" ") = :s(space)

    • GB82WEST12345698765432
    • Capture country code and checkdigits.
     line2 LEN(2) . country LEN(2) . checkdigits
    • 1. Is the country code known?
     IDENT(ibant<country>)

+ invalid(line, "unlisted country: " country) :s(read)

    • 2. Is the length correct for the country?
     NE(SIZE(line2), ibant<country>)

+ invalid(line, "length: " SIZE(line2) + " not " ibant<country>) :s(read)

    • 3. Move first four chars to end of line.
    • Convert line2 letters to numbers.
    • 3214282912345698765432161182
     line2 = SUBSTR(line2,5) SUBSTR(line2,1,4)
     line2 = tonumbers(line2)
    • Mod_97 of line2 = 1?
     modsum  = mod(line2, 97)
     NE(modsum, 1)

+ invalid(line, "mod_97 " modsum " not = 1") :s(read)

     OUTPUT = "valid IBAN: " line                    :(read)

END</lang>

Output:

valid IBAN: GB82 WEST 1234 5698 7654 32
valid IBAN: GB82WEST12345698765432
valid IBAN: gb82 west 1234 5698 7654 32
Invalid IBAN: GB82 TEST 1234 5698 7654 3244: length: 24 not 22
Invalid IBAN: US12 3456 7890 0987 6543 210: unlisted country: US
Invalid IBAN: GB82 WEST 1234 5698 7654 33: mod_97 28 not = 1
Invalid IBAN: GB81 WEST 1234 5698 7654 32: mod_97 0 not = 1
valid IBAN: GB29 NWBK 6016 1331 9268 19
valid IBAN: SA03 8000 0000 6080 1016 7519
valid IBAN: CH93 0076 2011 6238 5295 7
valid IBAN: IL62 0108 0000 0009 9999 999
Invalid IBAN: IL62-0108-0000-0009-9999-999: length: 28 not 23
Invalid IBAN: GR16 0110 1250 0000 0001 2300 695X: length: 28 not 27


Standard ML

Works with: SML/NJ

<lang sml>(* country_code : string -> int *) (* Get the length of a valid IBAN given the two chars long country code *) fun country_code (str : string) : int =

 case str of
   "AL" => 28 | "AD" => 24 | "AT" => 20 | "AZ" => 28
 | "BE" => 16 | "BH" => 22 | "BA" => 20 | "BR" => 29
 | "BG" => 22 | "CR" => 21 | "HR" => 21 | "CY" => 28
 | "CZ" => 24 | "DK" => 18 | "DO" => 28 | "EE" => 20
 | "FO" => 18 | "FI" => 18 | "FR" => 27 | "GE" => 22
 | "DE" => 22 | "GI" => 23 | "GR" => 27 | "GL" => 18
 | "GT" => 28 | "HU" => 28 | "IS" => 26 | "IE" => 22
 | "IL" => 23 | "IT" => 27 | "KZ" => 20 | "KW" => 30
 | "LV" => 21 | "LB" => 28 | "LI" => 21 | "LT" => 20
 | "LU" => 20 | "MK" => 19 | "MT" => 31 | "MR" => 27
 | "MU" => 30 | "MC" => 27 | "MD" => 24 | "ME" => 22
 | "NL" => 18 | "NO" => 15 | "PK" => 24 | "PS" => 29
 | "PL" => 28 | "PT" => 25 | "RO" => 24 | "SM" => 27
 | "SA" => 24 | "RS" => 22 | "SK" => 24 | "SI" => 19
 | "ES" => 24 | "SE" => 24 | "CH" => 21 | "TN" => 24
 | "TR" => 26 | "AE" => 23 | "GB" => 22 | "VG" => 24
 | _ => raise Domain


(* removespace : string -> string *) (* Removes all spaces from a string *) fun removespace s = String.translate (fn #" " => "" | c => str c) s

(* to_upper : string -> string *) (* Convert every char to upper of a string *) fun to_upper (s : string) : string =

 String.translate (fn c => str (Char.toUpper c)) s

(* convert_to_number : char -> string *) (* Covert a alphanumeric char into a numerical string *) fun convert_to_number (c : char) : string =

 if Char.isDigit c then str c else
   if Char.isUpper c then Int.toString (10 + ord c - ord #"A") else
     raise Domain


(* verify_iban : string -> bool *) (* Check weather a string is a valid IBAN *) fun verify_iban str =

 let
   (* Remove spaces and make upper case *)
   val str = to_upper (removespace str)
   (* Fetch first two chars (country code) *)
   val country = String.substring (str, 0, 2)
   val len = country_code country
 in
   (* size test *)
   String.size str = len
   andalso
   (* Every char must be alphanumeric *)
   List.all Char.isAlphaNum (explode str)
   andalso
   let
     (* Reorder *)
     val str = String.substring (str, 4, String.size str - 4) ^ String.substring (str, 0, 4)
     (* Convert into digits *)
     val str = String.translate convert_to_number str
     (* Convert into a big number *)
     val number = valOf (IntInf.fromString str)
   in
     IntInf.mod (number, 97) = 1
   end
 end handle Subscript => false | Domain => false</lang>
Output:
- verify_iban "GB82 WEST 1234 5698 7654 32";
val it = true : bool
- verify_iban "GB82 TEST 1234 5698 7654 32";
val it = false : bool

Tcl

<lang tcl>proc verifyIBAN {iban} {

   # Normalize by up-casing and stripping illegal chars (e.g., space)
   set iban [regsub -all {[^A-Z0-9]+} [string toupper $iban] ""]
   # Get the expected length from the country-code part
   switch [string range $iban 0 1] {

NO { set len 15 } BE { set len 16 } DK - FI - FO - GL - NL { set len 18} MK - SI { set len 19 } AT - BA - EE - KZ - LT - LU { set len 20 } CH - CR - HR - LI - LV { set len 21 } BG - BH - DE - GB - GE - IE - ME - RS { set len 22 } AE - GI - IL { set len 23 } AD - CZ - ES - MD - PK - RO - SA - SE - SK - TN - VG { set len 24 } PT { set len 25 } IS - TR { set len 26 } FR - GR - IT - MC - MR - SM { set len 27 } AL - AZ - CY - DO - GT - HU - LB - PL { set len 28 } BR - PS { set len 29 } KW - MU { set len 30 } MT { set len 31 } default { # unsupported country code return false }

   }
   # Convert to number
   set num [string map {

A 10 B 11 C 12 D 13 E 14 F 15 G 16 H 17 I 18 J 19 K 20 L 21 M 22 N 23 O 24 P 25 Q 26 R 27 S 28 T 29 U 30 V 31 W 32 X 33 Y 34 Z 35

   } [string range $iban 4 end][string range $iban 0 3]]
   # Verify length and modulus
   return [expr {[string length $iban] == $len && $num % 97 == 1}]

}</lang>Demonstrating: <lang tcl>set iban "GB82 WEST 1234 5698 7654 32" puts "$iban is [expr {[verifyIBAN $iban] ? {verified} : {unverified}}]" set not "GB42 WEST 1234 5698 7654 32"

puts "$not is [expr {[verifyIBAN $not] ? {verified} : {unverified}}]"</lang>

Output:
GB82 WEST 1234 5698 7654 32 is verified
GB42 WEST 1234 5698 7654 32 is unverified

UNIX Shell

Works with: bash

This does not verify the country code or the length. <lang bash>declare -A base36=(

   [A]=10 [B]=11 [C]=12 [D]=13 [E]=14 [F]=15 [G]=16 [H]=17 [I]=18
   [J]=19 [K]=20 [L]=21 [M]=22 [N]=23 [O]=24 [P]=25 [Q]=26 [R]=27
   [S]=28 [T]=29 [U]=30 [V]=31 [W]=32 [X]=33 [Y]=34 [Z]=35

)

function is_iban {

   local -u acct=${1//[^[:alnum:]]/}
   acct=${acct:4}${acct:0:4}
   local i char digits=""
   for ((i=0; i<${#acct}; i++)); do
       char=${acct:i:1}
       digits+=${base36[$char]:-$char}
   done
   local mod=$(mod97 $digits)
   (( mod == 1 ))

}

function mod97 {

   local D=$1
   N=${D:0:9}
   D=${D:9}
   while -n $D ; do
       mod=$(( N % 97 ))
       N=$(printf "%02d%s" $mod ${D:0:7})
       D=${D:7}
   done
   echo $(( N % 97 ))

}

for test in "GB82 WEST 1234 5698 7654 32" "GB42 WEST 1234 5698 7654 32"; do

   printf "%s : " "$test"
   is_iban "$test" && echo yes || echo no

done</lang>

Output:
GB82 WEST 1234 5698 7654 32 : yes
GB42 WEST 1234 5698 7654 32 : no

VBScript

<lang vb> Function validate_iban(s) validate_iban = Chr(34) & s & Chr(34) & " is NOT valid." Set cn_len = CreateObject("Scripting.Dictionary") With cn_len .Add "AL",28 : .Add "AD",24 : .Add "AT",20 : .Add "AZ",28 : .Add "BH",22 : .Add "BE",16 .Add "BA",20 : .Add "BR",29 : .Add "BG",22 : .Add "CR",21 : .Add "HR",21 : .Add "CY",28 .Add "CZ",24 : .Add "DK",18 : .Add "DO",28 : .Add "EE",20 : .Add "FO",18 : .Add "FI",18 .Add "FR",27 : .Add "GE",22 : .Add "DE",22 : .Add "GI",23 : .Add "GR",27 : .Add "GL",18 .Add "GT",28 : .Add "HU",28 : .Add "IS",26 : .Add "IE",22 : .Add "IL",23 : .Add "IT",27 .Add "JO",30 : .Add "KZ",20 : .Add "KW",30 : .Add "LV",21 : .Add "LB",28 : .Add "LI",21 .Add "LT",20 : .Add "LU",20 : .Add "MK",19 : .Add "MT",31 : .Add "MR",27 : .Add "MU",30 .Add "MC",27 : .Add "MD",24 : .Add "ME",22 : .Add "NL",18 : .Add "NO",15 : .Add "PK",24 .Add "PS",29 : .Add "PL",28 : .Add "PT",25 : .Add "QA",29 : .Add "RO",24 : .Add "SM",27 .Add "SA",24 : .Add "RS",22 : .Add "SK",24 : .Add "SI",19 : .Add "ES",24 : .Add "SE",24 .Add "CH",21 : .Add "TN",24 : .Add "TR",26 : .Add "AE",23 : .Add "GB",22 : .Add "VG",24 End With iban = Replace(s," ","") If cn_len.Exists(Left(iban,2)) And Len(iban) = cn_len.Item(Left(iban,2)) Then 'move the first 4 characters to the end iban = Mid(iban,5,Len(iban)-4) & Left(iban,4) 'convert letters to numbers A=10 to Z=35 D = "" For i = 1 To Len(iban) If Asc(Mid(iban,i,1)) >= 65 And Asc(Mid(iban,i,1)) <= 90 Then D = D & CStr(Asc(Mid(iban,i,1)) - 55) Else D = D & Mid(iban,i,1) End If Next 'piece-wise modulo calculation Do If Len(D) > 9 Then N = CLng(Left(D,9)) Mod 97 D = CStr(N) & Mid(D,10,Len(D)-9) Else N = CLng(Left(D,9)) Mod 97 Exit Do End If Loop If N = 1 Then validate_iban = Chr(34) & s & Chr(34) & " is valid." End If End If End Function

'test several scenarios WScript.StdOut.WriteLine validate_iban("GB82 WEST 1234 5698 7654 32") WScript.StdOut.WriteLine validate_iban("GB82WEST12345698765432") WScript.StdOut.WriteLine validate_iban("gb82 west 1234 5698 7654 32") WScript.StdOut.WriteLine validate_iban("GB82 TEST 1234 5698 7654 32") WScript.StdOut.WriteLine validate_iban("GR16 0110 1250 0000 0001 2300 695") WScript.StdOut.WriteLine validate_iban("GB29 NWBK 6016 1331 9268 19") WScript.StdOut.WriteLine validate_iban("SA03 8000 0000 6080 1016 7519") WScript.StdOut.WriteLine validate_iban("CH93 0076 2011 6238 5295 7") WScript.StdOut.WriteLine validate_iban("IL62 0108 0000 0009 9999 999") WScript.StdOut.WriteLine validate_iban("IL62-0108-0000-0009-9999-999") WScript.StdOut.WriteLine validate_iban("US12 3456 7890 0987 6543 210") WScript.StdOut.WriteLine validate_iban("GR16 0110 1250 0000 0001 2300 695X") </lang>

Output:
"GB82 WEST 1234 5698 7654 32" is valid.
"GB82WEST12345698765432" is valid.
"gb82 west 1234 5698 7654 32" is NOT valid.
"GB82 TEST 1234 5698 7654 32" is NOT valid.
"GR16 0110 1250 0000 0001 2300 695" is valid.
"GB29 NWBK 6016 1331 9268 19" is valid.
"SA03 8000 0000 6080 1016 7519" is valid.
"CH93 0076 2011 6238 5295 7" is valid.
"IL62 0108 0000 0009 9999 999" is valid.
"IL62-0108-0000-0009-9999-999" is NOT valid.
"US12 3456 7890 0987 6543 210" is NOT valid.
"GR16 0110 1250 0000 0001 2300 695X" is NOT valid.

zkl

Using GMP big nums: <lang zkl>var BN=Import("zklBigNum"); fcn validateIBAN(iban){

  iban=iban-" \t";
  alphaNums.matches(iban) and (ibans.find(iban[0,2])==iban.len()) and
  ( BN((iban[4,*]+iban[0,4]).apply("toInt",36)) % 97 == 1 )

}</lang>Without using big nums: <lang zkl>fcn validateIBAN(iban){

  iban=iban-" \t";
  alphaNums.matches(iban) and (ibans.find(iban[0,2])==iban.len()) and
  ( (iban[4,*]+iban[0,4]).apply("toInt",36) : mod97(_) == 1 )

} fcn mod97(str){

  n:=0; m:=9; M:=0; while(N:=str[n,m]){
     M=((M.toString()+N).toInt()) % 97;
     n+=m; m=7;
  }
  M

}</lang><lang zkl>var alphaNums=RegExp("^[0-9A-Z]+$"); var ibans= // Dictionary("AD":24, ...)

 ("AD24 AE23 AL28 AO25 AT20 AZ28 BA20 BE16 BF27 BG22 BH22 BI16 "
  "BJ28 BR29 CG27 CH21 CI28 CM27 CR21 CV25 CY28 CZ24 DE22 DK18 "
  "DO28 DZ24 EE20 EG27 ES24 FI18 FO18 FR27 GA27 GB22 GE22 GI23 "
  "GL18 GR27 GT28 HR21 HU28 IE22 IL23 IR26 IS26 IT27 JO30 KW30 "
  "KZ20 LB28 LI21 LT20 LU20 LV21 MC27 MD24 ME22 MG27 MK19 ML28 "
  "MR27 MT31 MU30 MZ25 NL18 NO15 PK24 PL28 PS29 PT25 QA29 RO24 "
  "RS22 SA24 SE24 SI19 SK24 SM27 SN28 TN24 TR26 UA29 VG24")
  .split(" ").pump(D(),fcn(w){return(w[0,2],w[2,*].toInt())});</lang>Testing 1 2 3 

<lang zkl> // all valid T("GB82 WEST 1234 5698 7654 32","GB82WEST12345698765432",

 "GR16 0110 1250 0000 0001 2300 695","GB29 NWBK 6016 1331 9268 19",
  "SA03 8000 0000 6080 1016 7519","CH93 0076 2011 6238 5295 7",
  "IL62 0108 0000 0009 9999 999")

.apply(validateIBAN).println();

 // all invalid

T("gb82 west 1234 5698 7654 32","GB82 TEST 1234 5698 7654 32",

 "GB82 WEST 1243 5698 7654 32","AE82 WEST 1234 5698 7654 32"
 "IL62-0108-0000-0009-9999-999","US12 3456 7890 0987 6543 210",
 "GR16 0110 1250 0000 0001 2300 695X","GT11 2222 3333 4444 5555 6666 7777",
 "MK11 2222 3333 4444 555")

.apply(validateIBAN).println();

  // white list from Scala

("AD1200012030200359100100 AE260211000000230064016 AL47212110090000000235698741 " ... "CH9300762011623852957").split() .apply(validateIBAN).toString(*).println();</lang>

Output:
L(True,True,True,True,True,True,True)
L(False,False,False,False,False,False,False,False)
L(True,True,True,True,True,True,True,True,True,True,True,True,
  True,True,True,True,True,True,True,True,True,True,True,True,True,
  True,True,True,True,True,True,True,True,True,True,True,True,True,
  True,True,True,True,True,True,True,True,True,True,True,True,True,
  True,True,True,True,True,True,True,True,True,True,True,True,
  Tre,True,True,True,True,True,True,True,True,True,True,True,
  True,True,True,True,True,True,True,True,True,True,True,True)

ZX Spectrum Basic

Translation of: BBC BASIC

<lang zxbasic>10 REM REM Used the following as official standard: 20 REM REM http://www.cnb.cz/cs/platebni_styk/iban/download/EBS204.pdf 30 REM REM Pairs of ISO 3166 country code & expected IBAN length for this country 40 LET c$="AL28 AD24 AT20 AZ28 BE16 BH22 BA20 BR29 BG22 CR21 HR21 CY28 CZ24 DK18 DO28 EE20 " 50 LET c$=c$+"FO18 FI18 FR27 GE22 DE22 GI23 GR27 GL18 GT28 HU28 IS26 IE22 IL23 IT27 KZ20 KW30 " 60 LET c$=c$+"LV21 LB28 LI21 LT20 LU20 MK19 MT31 MR27 MU30 MC27 MD24 ME22 NL18 NO15 PK24 PS29 " 70 LET c$=c$+"PL28 PT25 RO24 SM27 SA24 RS22 SK24 SI19 ES24 SE24 CH21 TN24 TR26 AE23 GB22 VG24 " 80 LET e$="" 100 LET i$="GB82 WEST 1234 5698 7654 32": GO SUB 1000 110 LET i$="gb82 west 1234 5698 7654 32": GO SUB 1000 120 LET i$="GB82 TEST 1234 5698 7654 32": GO SUB 1000 130 LET i$="GR16 0110 1250 0000 0001 2300 695": GO SUB 1000 140 LET i$="IL62-0108-0000-0009-9999-999": GO SUB 1000 900 STOP 1000 REM IBAN check routine 1010 LET explen=0: LET lenc=LEN c$ 1020 FOR i=1 TO lenc STEP 5 1030 IF i$( TO 2)=c$(i TO i+1) THEN LET explen=VAL c$(i+2 TO i+3): GO TO 2000 1040 NEXT i 2000 LET match=explen>0 2010 REM Continue if country code found 2020 IF NOT match THEN LET e$="country code: "+i$( TO 2): GO TO 3000 2030 REM Remove espace = convert to digital IBAN 2040 LET d$="" 2050 FOR i=1 TO LEN i$ 2060 IF i$(i)>" " THEN LET d$=d$+i$(i) 2070 NEXT i 2080 LET match=explen=LEN d$ 2090 REM Continue if length is correct 2100 IF NOT match THEN LET e$="code length, expected length: "+STR$ explen: GO TO 3000 2110 REM Create temporary string with country code appended 2120 LET t$=d$(5 TO )+d$(1 TO 2) 2130 REM Make big number, replacing letters by numbers using next conversion table: A=10 ... Z=35 2140 LET b$="" 2150 FOR i=1 TO LEN t$ 2160 LET c= CODE t$(i) 2170 IF (c>64 AND c<91) THEN LET b$=b$+STR$ (c-55): GO TO 2200 2190 IF (c>47 AND c<58) THEN LET b$=b$+t$(i) 2200 NEXT i 2210 REM MOD 97 on bignum$+"00" and subtract result from 98 to obtain control number 2220 LET k$=b$+"00": GO SUB 4000 2230 LET kk=98-mod97 2240 REM Compare with control number in IBAN 2250 LET match=VAL i$(3 TO 4)=kk 2260 REM Continue if control number matches 2270 IF NOT match THEN LET e$="check digits, should be: "+STR$ kk: GO TO 3000 2280 REM Append kk to bignum$ and determine if MOD 97 results in 1 2285 LET k$="0"+STR$ kk 2290 LET k$=b$+k$(LEN k$-1 TO ): GO SUB 4000 2300 LET match=mod97=1 2310 REM Continue if mod 97 2320 IF NOT match THEN LET e$="result from modulo 97" 3000 IF match THEN PRINT " ": GO TO 3100 3010 PRINT "in";: LET e$=" ***error!*** invalid "+e$ 3100 PRINT "valid IBAN: ";i$;e$: LET e$="" 3110 RETURN 4000 REM Modulo 97 4010 LET mod97=0 4020 FOR i=1 TO LEN k$ 4030 LET d$=STR$ (mod97)+k$(i) 4040 LET mod97=FN m(VAL (d$),97) 4050 NEXT i 4060 RETURN 5000 DEF FN m(a,b)=a-INT (a/b)*b: REM modulo</lang>