View source for Most frequent k chars distance

{{draft task}}

The string distance function (SDF) that is the subject of this entry
was proposed in a paper published in 2014 as a method for quickly
estimating how [[wp:Similarity measure|similar]] two 
[[wp:Order theory|ordered sets]] or 
[[wp:String (computer science)|strings]] are.
This SDF has also been proposed as being suitable in bioinformatics, e.g. for comparing sequences in the [[wp:fasta]] format.

Unfortunately, the original paper
by Sadi Evren Seker et al. 
(arXiv:1401.6596 [cs.DS])
<ref name="mfkc">{{citation
 | last1 = SEKER | first1 = Sadi E. | author1-link = Sadi Evren SEKER
 | last2 = Altun | first2 = Oguz
 | last3 = Ayan | first3 = Ugur 
 | last4 = Mert | first4 = Cihan
 | contribution = A Novel String Distance Function based on Most Frequent K Characters
 | volume = 4
 | issue = 2
 | pages = 177-183
 | publisher = [[wp:International Association of Computer Science and Information Technology Press (IACSIT Press)]]
 | title = [[wp:International Journal of Machine Learning and Computing (IJMLC)]]
 | url = https://arxiv.org/abs/1401.6596
 | year = 2014}}.</ref>
has a number of internal inconsistencies and for this and other
reasons is not entirely clear in several key respects, but the paper
does give some worked examples and several of these (notably the two
given under the "Worked Examples" heading below) agree with the
interpretation used by the authors of the Python entry herein, so that
interpretation is used in the present task description.

;The Task

(a) Show a time-efficient implementation of the SDF as if by a
function mostFreqKSDF(s1, s2, k, n), where s1 and s2 are arbitrary
strings, and k and n are non-negative integers as explained below;

(b) Show the values produced by the SDF for the following values of s1 and s2,
with k = 2 and n = 10:
{|class="wikitable"
|-
!String Inputs
!"Top Two"
!SDF Output (k=2, n=10)
|- 
|'night'
'nacht'
|n:1 i:1
n:1 a:1
|8
|- 
|'my'
'a'
|m:1 y:1
a:1
|10
|-
|‘research’
‘research’	
|r:2 e:2
r:2 e:2	
|2
|-
|-
|‘significant’
‘capabilities’	
|i:3 n:2
i:3 a:2	
|4
|}


(c) Show the value produced by the SDF for k = 2, n = 100,
and the two strings:

"LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
"EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"


; Reference Algorithm

The original paper employs an unusual scheme for encoding the
frequencies of single letters as a string of letters and numbers. This
scheme has several disadvantages, and so in the following we take a
more abstract view and simply assume, solely for the purposes
of this description, that two functions are available:

1) MostFreqK(s, k) returns (in decreasing order of their frequency of occurrence)
the k most frequently occurring letters in s, with
any ties broken by the position of the first occurrence in s;

2) For any letter c in MostFreqK(s, k), Freq(s,c) returns the frequency
of c in s.

; MFKsimilarity

Next define MFKsimilarlity(s1, s2, k) as if by the following pseudo-code:
<pre>
int function MFKsimilarity(string s1, string s2, int k):
    let similarity = 0
    let mfk1 = MostFreqK(s1, k)
    let mfk2 = MostFreqK(s2, k)
    for each c in mfk1
        if (c occurs in mfk2) 
        then similarity += Freq(s1, c) + Freq(s2, c)
	end
    return similarity
</pre>

; String Distance Wrapper Function

Now define MostFreqKSDF as if by:
<pre>
int function MostFreqKSDF(string s1, string s2, int k, int n)
    return n - MFKsimilarity(s1, s2, k)
</pre>

; Worked Examples:

The original paper gives several worked examples, including
these two:

(i) MostFreqKSDF("night", "nacht", 2, 10)

For "night", the "top two" letters with their frequencies are: n:1 and i:1.

For "nacht", the "top two" letters with their frequencies are: n:1 and a:1.

Since "n" is the only shared letter amongst these candidates, the
SDF is 10 - 1 - 1 = 8, as per the original paper.

(2) 
MostFreqKSDF(
"LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV",
"EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG",
2, 100)

For the first string, the "top two" letters with their frequencies are:  L:9 and T:8;
and for the second, the "top two" are F:9 and L:8.

Since "L" is the only shared letter amongst these top-k characters, and since the sum of the corresponding frequencies is 9+8 = 17, the SDF is 83.
<br/>

=={{header|11l}}==
{{trans|Python}}

<syntaxhighlight lang="11l">F most_freq_khashing(inputString, K)
   DefaultDict[Char, Int] occuDict
   L(c) inputString
      occuDict[c]++
   V occuList = sorted(occuDict.items(), key' x -> x[1], reverse' 1B)
   V outputDict = Dict(occuList[0 .< K])
   R outputDict

F most_freq_ksimilarity(inputStr1, inputStr2)
   V similarity = 0
   L(c, cnt1) inputStr1
      I c C inputStr2
         V cnt2 = inputStr2[c]
         similarity += cnt1 + cnt2
   R similarity

F most_freq_ksdf(inputStr1, inputStr2, K, maxDistance)
   R maxDistance - most_freq_ksimilarity(most_freq_khashing(inputStr1, K), most_freq_khashing(inputStr2, K))

V str1 = ‘LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV’
V str2 = ‘EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG’
V K = 2
V maxDistance = 100
V dict1 = most_freq_khashing(str1, 2)
print(dict1, end' ":\n")
print(dict1.map((c, cnt) -> c‘’String(cnt)).join(‘’))
V dict2 = most_freq_khashing(str2, 2)
print(dict2, end' ":\n")
print(dict2.map((c, cnt) -> c‘’String(cnt)).join(‘’))
print(most_freq_ksdf(str1, str2, K, maxDistance))</syntaxhighlight>

{{out}}
<pre>
[L = 9, T = 8]:
L9T8
[F = 9, L = 8]:
F9L8
83
</pre>

=={{header|C++}}==
<syntaxhighlight lang="cpp">#include <string>
#include <vector>
#include <map>
#include <iostream>
#include <algorithm>
#include <utility>
#include <sstream>

std::string mostFreqKHashing ( const std::string & input , int k ) {
   std::ostringstream oss ;
   std::map<char, int> frequencies ;
   for ( char c : input ) {
      frequencies[ c ] = std::count ( input.begin( ) , input.end( ) , c ) ;
   }
   std::vector<std::pair<char , int>> letters ( frequencies.begin( ) , frequencies.end( ) ) ;
   std::sort ( letters.begin( ) , letters.end( ) , [input] ( std::pair<char, int> a ,
	         std::pair<char, int> b ) { char fc = std::get<0>( a ) ; char fs = std::get<0>( b ) ; 
	         int o = std::get<1>( a ) ; int p = std::get<1>( b ) ; if ( o != p ) { return o > p ; }
	         else { return input.find_first_of( fc ) < input.find_first_of ( fs ) ; } } ) ;
   for ( int i = 0 ; i < letters.size( ) ; i++ ) {
      oss << std::get<0>( letters[ i ] ) ;
      oss << std::get<1>( letters[ i ] ) ;
   }
   std::string output ( oss.str( ).substr( 0 , 2 * k ) ) ;
   if ( letters.size( ) >= k ) {
      return output ;
   }
   else {
      return output.append( "NULL0" ) ;
   }
}

int mostFreqKSimilarity ( const std::string & first , const std::string & second ) {
   int i = 0 ;
   while ( i < first.length( ) - 1  ) {
      auto found = second.find_first_of( first.substr( i , 2 ) ) ;
      if ( found != std::string::npos ) 
	 return std::stoi ( first.substr( i , 2 )) ;
      else 
	 i += 2 ;
   }
   return 0 ;
}

int mostFreqKSDF ( const std::string & firstSeq , const std::string & secondSeq , int num ) {
   return mostFreqKSimilarity ( mostFreqKHashing( firstSeq , num ) , mostFreqKHashing( secondSeq , num ) ) ;
}

int main( ) {
   std::string s1("LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV" ) ;
   std::string s2( "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG" ) ;
   std::cout << "MostFreqKHashing( s1 , 2 ) = " << mostFreqKHashing( s1 , 2 ) << '\n' ;
   std::cout << "MostFreqKHashing( s2 , 2 ) = " << mostFreqKHashing( s2 , 2 ) << '\n' ;
   return 0 ;
}
</syntaxhighlight>
{{out}}
<pre>MostFreqKHashing( s1 , 2 ) = L9T8
MostFreqKHashing( s2 , 2 ) = F9L8
</pre>

=={{header|Go}}==
{{trans|Kotlin}}
<syntaxhighlight lang="go">package main

import (
    "fmt"
    "sort"
)

type cf struct {
    c rune
    f int
}

func reverseStr(s string) string {
    runes := []rune(s)
    for i, j := 0, len(runes)-1; i < j; i, j = i+1, j-1 {
        runes[i], runes[j] = runes[j], runes[i]
    }
    return string(runes)
}

func indexOfCf(cfs []cf, r rune) int {
    for i, cf := range cfs {
        if cf.c == r {
            return i
        }
    }
    return -1
}

func minOf(i, j int) int {
    if i < j {
        return i
    }
    return j
}

func mostFreqKHashing(input string, k int) string {
    var cfs []cf
    for _, r := range input {
        ix := indexOfCf(cfs, r)
        if ix >= 0 {
            cfs[ix].f++
        } else {
            cfs = append(cfs, cf{r, 1})
        }
    }
    sort.SliceStable(cfs, func(i, j int) bool {
        return cfs[i].f > cfs[j].f // descending, preserves order when equal
    })
    acc := ""
    min := minOf(len(cfs), k)
    for _, cf := range cfs[:min] {
        acc += fmt.Sprintf("%c%c", cf.c, cf.f)
    }
    return acc
}

func mostFreqKSimilarity(input1, input2 string) int {
    similarity := 0
    runes1, runes2 := []rune(input1), []rune(input2)
    for i := 0; i < len(runes1); i += 2 {
        for j := 0; j < len(runes2); j += 2 {
            if runes1[i] == runes2[j] {
                freq1, freq2 := runes1[i+1], runes2[j+1]
                if freq1 != freq2 {
                    continue // assuming here that frequencies need to match
                }
                similarity += int(freq1)
            }
        }
    }
    return similarity
}

func mostFreqKSDF(input1, input2 string, k, maxDistance int) {
    fmt.Println("input1 :", input1)
    fmt.Println("input2 :", input2)
    s1 := mostFreqKHashing(input1, k)
    s2 := mostFreqKHashing(input2, k)
    fmt.Printf("mfkh(input1, %d) = ", k)
    for i, c := range s1 {
        if i%2 == 0 {
            fmt.Printf("%c", c)
        } else {
            fmt.Printf("%d", c)
        }
    }
    fmt.Printf("\nmfkh(input2, %d) = ", k)
    for i, c := range s2 {
        if i%2 == 0 {
            fmt.Printf("%c", c)
        } else {
            fmt.Printf("%d", c)
        }
    }
    result := maxDistance - mostFreqKSimilarity(s1, s2)
    fmt.Printf("\nSDF(input1, input2, %d, %d) = %d\n\n", k, maxDistance, result)
}

func main() {
    pairs := [][2]string{
        {"research", "seeking"},
        {"night", "nacht"},
        {"my", "a"},
        {"research", "research"},
        {"aaaaabbbb", "ababababa"},
        {"significant", "capabilities"},
    }
    for _, pair := range pairs {
        mostFreqKSDF(pair[0], pair[1], 2, 10)
    }

    s1 := "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
    s2 := "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"
    mostFreqKSDF(s1, s2, 2, 100)
    s1 = "abracadabra12121212121abracadabra12121212121"
    s2 = reverseStr(s1)
    mostFreqKSDF(s1, s2, 2, 100)
}</syntaxhighlight>

{{out}}
<pre>
input1 : research
input2 : seeking
mfkh(input1, 2) = r2e2
mfkh(input2, 2) = e2s1
SDF(input1, input2, 2, 10) = 8

input1 : night
input2 : nacht
mfkh(input1, 2) = n1i1
mfkh(input2, 2) = n1a1
SDF(input1, input2, 2, 10) = 9

input1 : my
input2 : a
mfkh(input1, 2) = m1y1
mfkh(input2, 2) = a1
SDF(input1, input2, 2, 10) = 10

input1 : research
input2 : research
mfkh(input1, 2) = r2e2
mfkh(input2, 2) = r2e2
SDF(input1, input2, 2, 10) = 6

input1 : aaaaabbbb
input2 : ababababa
mfkh(input1, 2) = a5b4
mfkh(input2, 2) = a5b4
SDF(input1, input2, 2, 10) = 1

input1 : significant
input2 : capabilities
mfkh(input1, 2) = i3n2
mfkh(input2, 2) = i3a2
SDF(input1, input2, 2, 10) = 7

input1 : LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
input2 : EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
mfkh(input1, 2) = L9T8
mfkh(input2, 2) = F9L8
SDF(input1, input2, 2, 100) = 100

input1 : abracadabra12121212121abracadabra12121212121
input2 : 12121212121arbadacarba12121212121arbadacarba
mfkh(input1, 2) = 112a10
mfkh(input2, 2) = 112210
SDF(input1, input2, 2, 100) = 88
</pre>

=={{header|Haskell}}==
<syntaxhighlight lang="haskell">module MostFrequentK 
   where
import Data.List ( nub , sortBy )
import qualified Data.Set as S 

count :: Eq a => [a] -> a -> Int
count [] x = 0 
count ( x:xs ) k 
   |x == k = 1 + count xs k
   |otherwise = count xs k

orderedStatistics :: String -> [(Char , Int)]
orderedStatistics s = sortBy myCriterion $ nub $ zip s ( map (\c -> count s c ) s )
   where
      myCriterion :: (Char , Int) -> (Char , Int) -> Ordering
      myCriterion (c1 , n1) (c2, n2) 
	 |n1 > n2 = LT
	 |n1 < n2 = GT
	 |n1 == n2 = compare ( found c1 s ) ( found c2 s )
      found :: Char -> String -> Int
      found e s = length $ takeWhile (/= e ) s

mostFreqKHashing :: String -> Int -> String
mostFreqKHashing s n = foldl ((++)) [] $ map toString $ take n $ orderedStatistics s
   where
      toString :: (Char , Int) -> String
      toString ( c , i ) = c : show i

mostFreqKSimilarity :: String -> String -> Int
mostFreqKSimilarity s t = snd $ head $ S.toList $ S.fromList ( doublets s ) `S.intersection`
                           S.fromList ( doublets t )
   where
      toPair :: String -> (Char , Int)
      toPair s = ( head s , fromEnum ( head $ tail s ) - 48 )
      doublets :: String -> [(Char , Int)]
      doublets str = map toPair [take 2 $ drop start str | start <- [0 , 2 ..length str - 2]]
                           
mostFreqKSDF :: String -> String -> Int ->Int
mostFreqKSDF s t n = mostFreqKSimilarity ( mostFreqKHashing s n ) (mostFreqKHashing t n )
</syntaxhighlight>
{{out}}
<pre>mostFrequentKHashing "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV" 2
"L9T8"
*MostFrequentK> mostFrequentKHashing "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG" 2
"F9L8"
</pre>

=={{header|J}}==
'''Solution''':<syntaxhighlight lang="j">NB. String Distance Wrapper Function
mfksDF     =: {:@:[ - (mfks@:(mfkh&.>)~ {.)~

NB. Most Frequent K Distance
mfks       =:  score@:(charMap@:[ {"1 charVals@:])/@:kHashes 
  score    =.  ([ +/ .* =)/                  NB. (+ +/ .* *.&:*)/  for sum += freq_in_left + freq_in_right
  charMap  =.  (,&< i.&> <@:~.@:,)&;/
  charVals =.  (; , 0:)"1
  kHashes  =.  0 1 |: ({.&>~ [: <./ #&>)
  
NB. Most Frequent K Hashing
mfkh       =:   _&$: : (takeK freqHash)      NB. Default LHA of _ means "return complete frequency table"
  takeK    =.  (<.#) {. ]
  freqHash =.  ~. (] \:~ ,.&:(<"0)) #/.~ 

NB. No need to fix mfksDF
mfkh =: mfkh f.
mfks =: mfks f.</syntaxhighlight>

'''Examples''':<syntaxhighlight lang="j">verb define ''
	fkh =. ;@:,@:(":&.>) NB. format k hash

	assert. 'r2e2 e2s1' (-: [: fkh 2&mfkh)&>&;: 'research seeking'
	assert. 2 = mfks 2 mfkh&.> 'research';'seeking'

	assert. 'n1i1 n1a1' (-: [: fkh 2&mfkh)&>&;: 'night nacht'
	assert. 9 = 2 10 mfksDF 'night';'nacht'

	assert. 'm1y1 a1'  (-: [: fkh 2&mfkh)&>&;: 'my a'
	assert. 10 = 2 10 mfksDF 'my';'a'

	assert. 'r2e2' -: fkh 2 mfkh 'research'
	assert. 6 = 2 10 mfksDF 'research';'research'  NB. task says 8; right answer is 6

	assert. 'a5b4 a5b4' (-: [: fkh 2&mfkh)&>&;: 'aaaaabbbb ababababa'
	assert. 1 = 2 10 mfksDF 'aaaaabbbb';'ababababa'

	assert. 'i3n2 i3a2' (-: [: fkh 2&mfkh)&>&;:  'significant capabilities'
	assert. 7 = 2 10 mfksDF  'significant';'capabilities' NB. task says 5; right answer is 7

	assert. 'L9T8 F9L8' (-: [: fkh 2&mfkh)&>&;: 'LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG'
	assert. 100 = 2 100 mfksDF 'LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV';'EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG'
	NB. task says 83; right answer is 100

	'pass'
)
   pass</syntaxhighlight>
'''Notes''': As of press time, there are significant discrepancies between the task description, its pseudocode, the test cases provided, and the two other existing implementations. See the [[Talk:Most frequent k chars distance#Prank_Page.3F|talk page]] for the assumptions made in this implementation to reconcile these discrepancies (in particular, in the scoring function).

=={{header|Java}}==
{{incomplete|Java| Works now when there more than 10 occurences of a character in string. Please check, there can be more elegant way to deal with it. Comment was : This will fail catastrophically on “<tt>ABACADAEAFAEADACABA</tt>” as that has 10 ‘<tt>A</tt>’ characters in it.}}
Translation of the pseudo-code of the Wikipedia article [[wp:Most frequent k characters]] to [[wp:java]] implementation of three functions given in the definition section are given below with [[wp:JavaDoc]] comments:

<syntaxhighlight lang="java">import java.util.Collections;
import java.util.Comparator;
import java.util.HashMap;
import java.util.LinkedHashMap;
import java.util.ArrayList;
import java.util.List;
import java.util.Map;


public class SDF {

    /** Counting the number of occurrences of each character
     * @param character array
     * @return hashmap : Key = char, Value = num of occurrence
     */
    public static HashMap<Character, Integer> countElementOcurrences(char[] array) {

        HashMap<Character, Integer> countMap = new HashMap<Character, Integer>();

        for (char element : array) {
            Integer count = countMap.get(element);
            count = (count == null) ? 1 : count + 1;
            countMap.put(element, count);
        }

        return countMap;
    }
    
    /**
     * Sorts the counted numbers of characters (keys, values) by java Collection List
     * @param HashMap (with key as character, value as number of occurrences)
     * @return sorted HashMap
     */
    private static <K, V extends Comparable<? super V>>
            HashMap<K, V> descendingSortByValues(HashMap<K, V> map) { 
	List<Map.Entry<K, V>> list = new ArrayList<Map.Entry<K, V>>(map.entrySet());
	// Defined Custom Comparator here
	Collections.sort(list, new Comparator<Map.Entry<K, V>>() {
		public int compare(Map.Entry<K, V> o1, Map.Entry<K, V> o2) {
		    return o2.getValue().compareTo(o1.getValue());
		}
	    });

	// Here I am copying the sorted list in HashMap
	// using LinkedHashMap to preserve the insertion order
	HashMap<K, V> sortedHashMap = new LinkedHashMap<K, V>();
	for (Map.Entry<K, V> entry : list) {
	    sortedHashMap.put(entry.getKey(), entry.getValue());
	} 
	return sortedHashMap;
    }
    /**
     * get most frequent k characters
     * @param array of characters
     * @param limit of k
     * @return hashed String 
     */
    public static String mostOcurrencesElement(char[] array, int k) {
        HashMap<Character, Integer> countMap = countElementOcurrences(array);
        System.out.println(countMap);
        Map<Character, Integer> map = descendingSortByValues(countMap); 
        System.out.println(map);
        int i = 0;
        String output = "";
        for (Map.Entry<Character, Integer> pairs : map.entrySet()) {
	    if (i++ >= k)
		break;
            output += "" + pairs.getKey() + pairs.getValue();
        }
        return output;
    }
    /**
     * Calculates the similarity between two input strings
     * @param input string 1
     * @param input string 2
     * @param maximum possible limit value 
     * @return distance as integer
     */
    public static int getDiff(String str1, String str2, int limit) {
        int similarity = 0;
	int k = 0;
	for (int i = 0; i < str1.length() ; i = k) {
	    k ++;
	    if (Character.isLetter(str1.charAt(i))) {
		int pos = str2.indexOf(str1.charAt(i));
				
		if (pos >= 0) {	
		    String digitStr1 = "";
		    while ( k < str1.length() && !Character.isLetter(str1.charAt(k))) {
			digitStr1 += str1.charAt(k);
			k++;
		    }
					
		    int k2 = pos+1;
		    String digitStr2 = "";
		    while (k2 < str2.length() && !Character.isLetter(str2.charAt(k2)) ) {
			digitStr2 += str2.charAt(k2);
			k2++;
		    }
					
		    similarity += Integer.parseInt(digitStr2)
			+ Integer.parseInt(digitStr1);
					
		} 
	    }
	}
	return Math.abs(limit - similarity);
    }
    /**
     * Wrapper function 
     * @param input string 1
     * @param input string 2
     * @param maximum possible limit value 
     * @return distance as integer
     */
    public static int SDFfunc(String str1, String str2, int limit) {
        return getDiff(mostOcurrencesElement(str1.toCharArray(), 2), mostOcurrencesElement(str2.toCharArray(), 2), limit);
    }

    public static void main(String[] args) {
        String input1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV";
        String input2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG";
        System.out.println(SDF.SDFfunc(input1,input2,100));

    }

}</syntaxhighlight>


=={{header|Javascript}}==
Defines the functions for counting and frequency outside of the hashing function, as it is easier to calculate the comparison from a structured result rather than parsing a hash.

<syntaxhighlight lang="javascript">//returns an object of counts keyed by character
const kCounts = str => {
  const counts = {};
  for (let char of str) {
    counts[char] = counts[char] ? counts[char] + 1 : 1;
  }
  return counts;
};

//returns an array of length k containing the characters with the highest counts
const frequentK = (counts, k) => {
  //note that this is written for clarity rather than speed,
  //as it sorts all of the counts when only the top k are needed
  return Object.keys(counts)
    .sort((a, b) => counts[b] - counts[a])
    .slice(0, k);
};

//returns a hashed string of the most frequent k characters and their frequencies
const mostFreqKHashing = (str, k) => {
  const counts = kCounts(str);
  return frequentK(counts, k)
    .map(char => char + counts[char])
    .join("");
};

//numeric score of similarity based on the sum of counts of characters appearing in the top k of both strings
const mostFreqKSimilarity = (str1, str2, k) => {
  const counts1 = kCounts(str1);
  const counts2 = kCounts(str2);
  const freq1 = frequentK(counts1, k);
  const freq2 = frequentK(counts2, k);
  let similarity = 0;
  for (let char of freq1) {
    //only considers a character if it is in the top k of both strings
    if (freq2.includes(char)) {
      //the examples on this page are inconsistent in whether the similarity
      //should be the sum of the two counts or only the shared count (the minimum of the two)
      //this code uses the sum
      similarity += counts1[char] + counts2[char];
    }
  }
  return similarity;
};

//subtracts the similarity score from the maxDifference
const mostFreqKSDF = (str1, str2, k, maxDistance) => {
  return maxDistance - mostFreqKSimilarity(str1, str2, k);
};</syntaxhighlight>

'''Testing with Jest'''
<syntaxhighlight lang="javascript">test('hash of "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV" is "L9T8"', () => {
  expect(mostFreqKHashing(str1, 2)).toBe("L9T8");
});

test('hash of "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG" is "F9L8"', () => {
  expect(mostFreqKHashing(str2, 2)).toBe("F9L8");
});

test("SDF of strings 1 and 2 with k=2 and max=100 is 83", () => {
  expect(mostFreqKSDF(str1, str2, 2, 100)).toBe(83);
});</syntaxhighlight>

'''Testing in Console'''
<syntaxhighlight lang="javascript">const str1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV";
const str2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG";
const K = 2;
const maxDistance = 100;
console.log(mostFreqKHashing(str1, K));
console.log(mostFreqKHashing(str2, K));
console.log(mostFreqKSDF(str1, str2, K, maxDistance));</syntaxhighlight>

{{out}}
<pre>L9T8 
F9L8 
83</pre>

=={{header|jq}}==
{{works with|jq}}
'''Works with gojq, the Go implementation of jq'''

'''Preliminaries'''
<syntaxhighlight lang="jq"># bag of words
def bow(stream): 
  reduce stream as $word ({}; .[($word|tostring)] += 1);

# Like sort_by(f) but for items that compare equal, retain the original order
def sort_by_decreasing(f):
  # Add $n-$i
  def enumerate: . as $in | length as $n | reduce range(0;$n) as $i ([]; . + [ [$n-$i, $in[$i] ] ]);
  enumerate 
  | sort_by((.[1]|f), .[0])
  | reverse
  | map(.[1]);</syntaxhighlight>
'''The Tasks'''
<syntaxhighlight lang="jq"># Output: { characters: array_of_characters_in_decreasing_order_of_frequency, frequency: object}
def MostFreqKHashing($K):
  def chars: explode | range(0;length) as $i | [.[$i]] | implode;
  . as $in
  | bow(tostring | chars) as $bow
  | $bow
  | to_entries
  | sort_by_decreasing(.value)  # if two chars have same frequency than get the first occurrence in $in
  | (reduce .[0:$K][] as $kv ({}; .[$kv.key] = $kv.value) ) as $frequency
  | {characters: map(.key)[:$K], $frequency};

def MostFreqKSimilarity($in1; $in2; $K):
  [$in1, $in2] | map( MostFreqKHashing($K)) as [$s1, $s2]
  | reduce $s1.characters[] as $c (0;
      $s2.frequency[$c] as $f
      | if $f then . + $s1.frequency[$c] + $f
        else . end) ;

def MostFreqKSDF($inputStr1; $inputStr2; $K; $maxDistance):
    $maxDistance - MostFreqKSimilarity($inputStr1; $inputStr2; $K);

def MostFreqKSDF($K; $maxDistance):
   . as [$inputStr1, $inputStr2]
   | $maxDistance - MostFreqKSimilarity($inputStr1; $inputStr2; $K);

def task2:
  ["night", "nacht"],
  ["my", "a"],
  ["research", "research"],
  ["research", "seeking"],
  ["significant", "capabilities"]
  | MostFreqKSDF(2; 10) as $sdk
  | [., $sdk] ;

def task100:
  ["LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV",
   "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"]
  | MostFreqKSDF(2; 100);

task2, task100</syntaxhighlight>
{{out}}
<pre>
[["night","nacht"],8]
[["my","a"],10]
[["research","research"],2]
[["research","seeking"],6]
[["significant","capabilities"],4]
83
</pre>

=={{header|Kotlin}}==
The code for the MostFreqKSimilarity function differs in this task from that in the associated Wikipedia article. Also the description is inconsistent with the code in both cases. 

What I've decided to assume is that the frequency for commonly occurring characters must be the same in both strings for it to be added to the 'similarity' variable which seems to be the implication of both descriptions. This gives the same results as the Wikipedia article for all except the last example where it gives 100 rather than 83.

It's also evident that you can't just add the frequency of each character to the output string of the MostFreqKHashing function and then expect to be able to parse it afterwards. This is because, in the general case, any printing characters (including digits) could occur in the input string and the frequency could be more than 9. I've therefore encoded the frequency as the character with the same unicode value rather than the frequency itself.

I have no idea what NULL0 is supposed to mean so I've ignored that.
<syntaxhighlight lang="scala">// version 1.1.51

fun mostFreqKHashing(input: String, k: Int): String = 
    input.groupBy { it }.map { Pair(it.key, it.value.size) }
                        .sortedByDescending { it.second } // preserves original order when equal
                        .take(k)
                        .fold("") { acc, v -> acc + "${v.first}${v.second.toChar()}" }

fun mostFreqKSimilarity(input1: String, input2: String): Int {
    var similarity = 0
    for (i in 0 until input1.length step 2) {
        for (j in 0 until input2.length step 2) {
            if (input1[i] == input2[j]) {
                val freq1 = input1[i + 1].toInt()
                val freq2 = input2[j + 1].toInt()
                if (freq1 != freq2) continue  // assuming here that frequencies need to match
                similarity += freq1
            }
        }
    }
    return similarity
}

fun mostFreqKSDF(input1: String, input2: String, k: Int, maxDistance: Int) {
    println("input1 : $input1")
    println("input2 : $input2")
    val s1 = mostFreqKHashing(input1, k)
    val s2 = mostFreqKHashing(input2, k)
    print("mfkh(input1, $k) = ")
    for ((i, c) in s1.withIndex()) print(if (i % 2 == 0) c.toString() else c.toInt().toString())
    print("\nmfkh(input2, $k) = ")
    for ((i, c) in s2.withIndex()) print(if (i % 2 == 0) c.toString() else c.toInt().toString())
    val result = maxDistance - mostFreqKSimilarity(s1, s2)
    println("\nSDF(input1, input2, $k, $maxDistance) = $result\n")
}

fun main(args: Array<String>) {
    val pairs = listOf(
        Pair("research", "seeking"),
        Pair("night", "nacht"),
        Pair("my", "a"),
        Pair("research", "research"),
        Pair("aaaaabbbb", "ababababa"),
        Pair("significant", "capabilities")
    )
    for (pair in pairs) mostFreqKSDF(pair.first, pair.second, 2, 10)

    var s1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
    var s2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"
    mostFreqKSDF(s1, s2, 2, 100)
    s1 = "abracadabra12121212121abracadabra12121212121"
    s2 = s1.reversed()
    mostFreqKSDF(s1, s2, 2, 100)
}</syntaxhighlight>

{{out}}
<pre>
input1 : research
input2 : seeking
mfkh(input1, 2) = r2e2
mfkh(input2, 2) = e2s1
SDF(input1, input2, 2, 10) = 8

input1 : night
input2 : nacht
mfkh(input1, 2) = n1i1
mfkh(input2, 2) = n1a1
SDF(input1, input2, 2, 10) = 9

input1 : my
input2 : a
mfkh(input1, 2) = m1y1
mfkh(input2, 2) = a1
SDF(input1, input2, 2, 10) = 10

input1 : research
input2 : research
mfkh(input1, 2) = r2e2
mfkh(input2, 2) = r2e2
SDF(input1, input2, 2, 10) = 6

input1 : aaaaabbbb
input2 : ababababa
mfkh(input1, 2) = a5b4
mfkh(input2, 2) = a5b4
SDF(input1, input2, 2, 10) = 1

input1 : significant
input2 : capabilities
mfkh(input1, 2) = i3n2
mfkh(input2, 2) = i3a2
SDF(input1, input2, 2, 10) = 7

input1 : LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
input2 : EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
mfkh(input1, 2) = L9T8
mfkh(input2, 2) = F9L8
SDF(input1, input2, 2, 100) = 100

input1 : abracadabra12121212121abracadabra12121212121
input2 : 12121212121arbadacarba12121212121arbadacarba
mfkh(input1, 2) = 112a10
mfkh(input2, 2) = 112210
SDF(input1, input2, 2, 100) = 88
</pre>

=={{header|Nim}}==
It is impossible to get consistent results. We chose to implement Wikipedia algorithm (note that the page is no longer available, except in Internet Archive). With this algorithm, we get the same results as those of Wikipedia except for the last example where we get 91 instead of 83.

In order to avoid the limitation to 10 occurrences, we chose to use an ordered table (equivalent to Python OrderedDict). We could have used Kotlin solution or used a sequence of tuples (char, count) but the ordered table gives better performance.

<syntaxhighlight lang="nim">import algorithm, sugar, tables

type CharCounts = OrderedTable[char, int]

func `$`(counts: CharCounts): string =
  for (c, count) in counts.pairs:
    result.add $c & $count

func mostFreqKHashing(str: string; k: Positive): CharCounts =
  var counts: CharCounts                 # To get the counts in apparition order.
  for c in str: inc counts.mgetOrPut(c, 0)
  counts.sort((x, y) => cmp(x[1], y[1]), Descending)  # Note that sort is stable.
  var count = 0
  for c, val in counts.pairs:
    inc count
    result[c] = val
    if count == k: break

func mostFreqKSimilarity(input1, input2: CharCounts): int =
  for c, count in input1.pairs:
    if c in input2:
      result += count

func mostFreqKSDF(str1, str2: string; k, maxDistance: Positive): int =
  maxDistance - mostFreqKSimilarity(mostFreqKHashing(str1, k), mostFreqKHashing(str2, k))


const

  Pairs = [("night", "nacht"),
           ("my", "a"),
           ("research", "research"),
           ("aaaaabbbb", "ababababa"),
           ("significant", "capabilities")]

for (str1, str2) in Pairs:
  echo "str1: ", str1
  echo "str2: ", str2
  echo "mostFreqKHashing(str1, 2) = ", mostFreqKHashing(str1, 2)
  echo "mostFreqKHashing(str2, 2) = ", mostFreqKHashing(str2, 2)
  echo "mostFreqKSDF(str1, str2, 2, 10) = ", mostFreqKSDF(str1, str2, 2, 10)
  echo()

const
  S1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
  S2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"

echo "str1: ", S1
echo "str2: ", S2
echo "mostFreqKHashing(str1, 2) = ", mostFreqKHashing(S1, 2)
echo "mostFreqKHashing(str2, 2) = ", mostFreqKHashing(S2, 2)
echo "mostFreqKSDF(str1, str2, 2, 100) = ", mostFreqKSDF(S1, S2, 2, 100)</syntaxhighlight>

{{out}}
<pre>str1: night
str2: nacht
mostFreqKHashing(str1, 2) = n1i1
mostFreqKHashing(str2, 2) = n1a1
mostFreqKSDF(str1, str2, 2, 10) = 9

str1: my
str2: a
mostFreqKHashing(str1, 2) = m1y1
mostFreqKHashing(str2, 2) = a1
mostFreqKSDF(str1, str2, 2, 10) = 10

str1: research
str2: research
mostFreqKHashing(str1, 2) = r2e2
mostFreqKHashing(str2, 2) = r2e2
mostFreqKSDF(str1, str2, 2, 10) = 6

str1: aaaaabbbb
str2: ababababa
mostFreqKHashing(str1, 2) = a5b4
mostFreqKHashing(str2, 2) = a5b4
mostFreqKSDF(str1, str2, 2, 10) = 1

str1: significant
str2: capabilities
mostFreqKHashing(str1, 2) = i3n2
mostFreqKHashing(str2, 2) = i3a2
mostFreqKSDF(str1, str2, 2, 10) = 7

str1: LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
str2: EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
mostFreqKHashing(str1, 2) = L9T8
mostFreqKHashing(str2, 2) = F9L8
mostFreqKSDF(str1, str2, 2, 100) = 91</pre>

=={{header|Perl}}==
<syntaxhighlight lang="perl">#!/usr/bin/perl 
use strict ;
use warnings ;

sub mostFreqHashing {
   my $inputstring = shift ;
   my $howmany = shift ;
   my $outputstring ;
   my %letterfrequencies = findFrequencies ( $inputstring ) ;
   my @orderedChars = sort { $letterfrequencies{$b} <=> $letterfrequencies{$a} ||
      index( $inputstring , $a ) <=> index ( $inputstring , $b ) } keys %letterfrequencies ;
   for my $i ( 0..$howmany - 1 ) {
      $outputstring .= ( $orderedChars[ $i ] . $letterfrequencies{$orderedChars[ $i ]} ) ;
   }
   return $outputstring ;
}

sub findFrequencies {
   my $input = shift ;
   my %letterfrequencies ;
   for my $i ( 0..length( $input ) - 1 ) {
      $letterfrequencies{substr( $input , $i , 1 ) }++ ;
   }
   return %letterfrequencies ;
}

sub mostFreqKSimilarity {
   my $first = shift ;
   my $second = shift ;
   my $similarity = 0 ;
   my %frequencies_first = findFrequencies( $first ) ;
   my %frequencies_second = findFrequencies( $second ) ;
   foreach my $letter ( keys %frequencies_first ) {
      if ( exists ( $frequencies_second{$letter} ) ) {
	 $similarity += ( $frequencies_second{$letter} + $frequencies_first{$letter} ) ;
      }
   }
   return $similarity ;
}

sub mostFreqKSDF {
   (my $input1 , my $input2 , my $k , my $maxdistance ) = @_ ;
   return $maxdistance - mostFreqKSimilarity( mostFreqHashing( $input1 , $k) ,
	 mostFreqHashing( $input2 , $k) ) ;
}

my $firststring = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV" ;
my $secondstring = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG" ;
print "MostFreqKHashing ( " . '$firststring , 2)' . " is " . mostFreqHashing( $firststring , 2 ) . "\n" ;
print "MostFreqKHashing ( " . '$secondstring , 2)' . " is " . mostFreqHashing( $secondstring , 2 ) . "\n" ;
</syntaxhighlight>
{{out}}
<pre>MostFreqKHashing ( $firststring , 2) is L9T8
MostFreqKHashing ( $secondstring , 2) is F9L8</pre>

=={{header|Phix}}==
{{trans|Go}}
<!--<syntaxhighlight lang="phix">(phixonline)-->
 <span style="color: #008080;">with</span> <span style="color: #008080;">javascript_semantics</span>
 <span style="color: #008080;">function</span> <span style="color: #000000;">mostFreqKHashing</span><span style="color: #0000FF;">(</span><span style="color: #004080;">string</span> <span style="color: #000000;">input</span><span style="color: #0000FF;">,</span> <span style="color: #004080;">integer</span> <span style="color: #000000;">k</span><span style="color: #0000FF;">)</span>
     <span style="color: #004080;">string</span> <span style="color: #000000;">cfs</span> <span style="color: #0000FF;">=</span> <span style="color: #008000;">""</span>
     <span style="color: #004080;">sequence</span> <span style="color: #000000;">cfsnx</span> <span style="color: #0000FF;">=</span> <span style="color: #0000FF;">{}</span>
     <span style="color: #008080;">for</span> <span style="color: #000000;">i</span><span style="color: #0000FF;">=</span><span style="color: #000000;">1</span> <span style="color: #008080;">to</span> <span style="color: #7060A8;">length</span><span style="color: #0000FF;">(</span><span style="color: #000000;">input</span><span style="color: #0000FF;">)</span> <span style="color: #008080;">do</span>
         <span style="color: #004080;">integer</span> <span style="color: #000000;">r</span> <span style="color: #0000FF;">=</span> <span style="color: #000000;">input</span><span style="color: #0000FF;">[</span><span style="color: #000000;">i</span><span style="color: #0000FF;">],</span>
                 <span style="color: #000000;">ix</span> <span style="color: #0000FF;">=</span> <span style="color: #7060A8;">find</span><span style="color: #0000FF;">(</span><span style="color: #000000;">r</span><span style="color: #0000FF;">,</span><span style="color: #000000;">cfs</span><span style="color: #0000FF;">)</span>
         <span style="color: #008080;">if</span> <span style="color: #000000;">ix</span><span style="color: #0000FF;">></span><span style="color: #000000;">0</span> <span style="color: #008080;">then</span>
             <span style="color: #000000;">cfsnx</span><span style="color: #0000FF;">[</span><span style="color: #000000;">ix</span><span style="color: #0000FF;">][</span><span style="color: #000000;">1</span><span style="color: #0000FF;">]</span> <span style="color: #0000FF;">-=</span> <span style="color: #000000;">1</span>
         <span style="color: #008080;">else</span>
             <span style="color: #000000;">cfs</span> <span style="color: #0000FF;">&=</span> <span style="color: #000000;">r</span>
             <span style="color: #000000;">cfsnx</span> <span style="color: #0000FF;">=</span> <span style="color: #7060A8;">append</span><span style="color: #0000FF;">(</span><span style="color: #000000;">cfsnx</span><span style="color: #0000FF;">,{-</span><span style="color: #000000;">1</span><span style="color: #0000FF;">,</span><span style="color: #7060A8;">length</span><span style="color: #0000FF;">(</span><span style="color: #000000;">cfs</span><span style="color: #0000FF;">)})</span>
         <span style="color: #008080;">end</span> <span style="color: #008080;">if</span>
     <span style="color: #008080;">end</span> <span style="color: #008080;">for</span>
     <span style="color: #000000;">cfsnx</span> <span style="color: #0000FF;">=</span> <span style="color: #7060A8;">sort</span><span style="color: #0000FF;">(</span><span style="color: #000000;">cfsnx</span><span style="color: #0000FF;">)</span> <span style="color: #000080;font-style:italic;">-- (aside: the idx forces stable sort)</span>
     <span style="color: #004080;">sequence</span> <span style="color: #000000;">acc</span> <span style="color: #0000FF;">:=</span> <span style="color: #0000FF;">{}</span>
     <span style="color: #008080;">for</span> <span style="color: #000000;">i</span><span style="color: #0000FF;">=</span><span style="color: #000000;">1</span> <span style="color: #008080;">to</span> <span style="color: #7060A8;">min</span><span style="color: #0000FF;">(</span><span style="color: #7060A8;">length</span><span style="color: #0000FF;">(</span><span style="color: #000000;">cfs</span><span style="color: #0000FF;">),</span><span style="color: #000000;">k</span><span style="color: #0000FF;">)</span> <span style="color: #008080;">do</span>
         <span style="color: #004080;">integer</span> <span style="color: #0000FF;">{</span><span style="color: #000000;">n</span><span style="color: #0000FF;">,</span><span style="color: #000000;">ix</span><span style="color: #0000FF;">}</span> <span style="color: #0000FF;">=</span> <span style="color: #000000;">cfsnx</span><span style="color: #0000FF;">[</span><span style="color: #000000;">i</span><span style="color: #0000FF;">]</span>
         <span style="color: #000000;">acc</span> <span style="color: #0000FF;">&=</span> <span style="color: #0000FF;">{</span><span style="color: #000000;">cfs</span><span style="color: #0000FF;">[</span><span style="color: #000000;">ix</span><span style="color: #0000FF;">],</span> <span style="color: #0000FF;">-</span><span style="color: #000000;">n</span><span style="color: #0000FF;">}</span>
     <span style="color: #008080;">end</span> <span style="color: #008080;">for</span>
     <span style="color: #008080;">return</span> <span style="color: #000000;">acc</span>
 <span style="color: #008080;">end</span> <span style="color: #008080;">function</span>
  
 <span style="color: #008080;">function</span> <span style="color: #000000;">mostFreqKSimilarity</span><span style="color: #0000FF;">(</span><span style="color: #004080;">sequence</span> <span style="color: #000000;">input1</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">input2</span><span style="color: #0000FF;">)</span>
     <span style="color: #004080;">integer</span> <span style="color: #000000;">similarity</span> <span style="color: #0000FF;">:=</span> <span style="color: #000000;">0</span>
     <span style="color: #008080;">for</span> <span style="color: #000000;">i</span><span style="color: #0000FF;">=</span><span style="color: #000000;">1</span> <span style="color: #008080;">to</span> <span style="color: #7060A8;">length</span><span style="color: #0000FF;">(</span><span style="color: #000000;">input1</span><span style="color: #0000FF;">)</span> <span style="color: #008080;">by</span> <span style="color: #000000;">2</span> <span style="color: #008080;">do</span>
         <span style="color: #008080;">for</span> <span style="color: #000000;">j</span><span style="color: #0000FF;">=</span><span style="color: #000000;">1</span> <span style="color: #008080;">to</span> <span style="color: #7060A8;">length</span><span style="color: #0000FF;">(</span><span style="color: #000000;">input2</span><span style="color: #0000FF;">)</span> <span style="color: #008080;">by</span> <span style="color: #000000;">2</span> <span style="color: #008080;">do</span>
             <span style="color: #008080;">if</span> <span style="color: #000000;">input1</span><span style="color: #0000FF;">[</span><span style="color: #000000;">i</span><span style="color: #0000FF;">]</span> <span style="color: #0000FF;">==</span> <span style="color: #000000;">input2</span><span style="color: #0000FF;">[</span><span style="color: #000000;">j</span><span style="color: #0000FF;">]</span> <span style="color: #008080;">then</span>
                 <span style="color: #004080;">integer</span> <span style="color: #000000;">freq1</span> <span style="color: #0000FF;">=</span> <span style="color: #000000;">input1</span><span style="color: #0000FF;">[</span><span style="color: #000000;">i</span><span style="color: #0000FF;">+</span><span style="color: #000000;">1</span><span style="color: #0000FF;">],</span>
                         <span style="color: #000000;">freq2</span> <span style="color: #0000FF;">=</span> <span style="color: #000000;">input2</span><span style="color: #0000FF;">[</span><span style="color: #000000;">j</span><span style="color: #0000FF;">+</span><span style="color: #000000;">1</span><span style="color: #0000FF;">]</span>
                 <span style="color: #008080;">if</span> <span style="color: #000000;">freq1</span><span style="color: #0000FF;">=</span><span style="color: #000000;">freq2</span> <span style="color: #008080;">then</span>
                     <span style="color: #000000;">similarity</span> <span style="color: #0000FF;">+=</span> <span style="color: #000000;">freq1</span>
                 <span style="color: #008080;">end</span> <span style="color: #008080;">if</span>
             <span style="color: #008080;">end</span> <span style="color: #008080;">if</span>
         <span style="color: #008080;">end</span> <span style="color: #008080;">for</span>
     <span style="color: #008080;">end</span> <span style="color: #008080;">for</span>
     <span style="color: #008080;">return</span> <span style="color: #000000;">similarity</span>
 <span style="color: #008080;">end</span> <span style="color: #008080;">function</span>
  
 <span style="color: #008080;">function</span> <span style="color: #000000;">flat</span><span style="color: #0000FF;">(</span><span style="color: #004080;">sequence</span> <span style="color: #000000;">s</span><span style="color: #0000FF;">)</span>
     <span style="color: #004080;">string</span> <span style="color: #000000;">res</span> <span style="color: #0000FF;">=</span> <span style="color: #008000;">""</span>
     <span style="color: #008080;">for</span> <span style="color: #000000;">i</span><span style="color: #0000FF;">=</span><span style="color: #000000;">1</span> <span style="color: #008080;">to</span> <span style="color: #7060A8;">length</span><span style="color: #0000FF;">(</span><span style="color: #000000;">s</span><span style="color: #0000FF;">)</span> <span style="color: #008080;">by</span> <span style="color: #000000;">2</span> <span style="color: #008080;">do</span>
         <span style="color: #000000;">res</span> <span style="color: #0000FF;">&=</span> <span style="color: #7060A8;">sprintf</span><span style="color: #0000FF;">(</span><span style="color: #008000;">"%c%d"</span><span style="color: #0000FF;">,</span><span style="color: #000000;">s</span><span style="color: #0000FF;">[</span><span style="color: #000000;">i</span><span style="color: #0000FF;">..</span><span style="color: #000000;">i</span><span style="color: #0000FF;">+</span><span style="color: #000000;">1</span><span style="color: #0000FF;">])</span>
     <span style="color: #008080;">end</span> <span style="color: #008080;">for</span> 
     <span style="color: #008080;">return</span> <span style="color: #000000;">res</span>
 <span style="color: #008080;">end</span> <span style="color: #008080;">function</span>
  
 <span style="color: #008080;">procedure</span> <span style="color: #000000;">mostFreqKSDF</span><span style="color: #0000FF;">(</span><span style="color: #004080;">string</span> <span style="color: #000000;">input1</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">input2</span><span style="color: #0000FF;">,</span> <span style="color: #004080;">integer</span> <span style="color: #000000;">k</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">maxDistance</span><span style="color: #0000FF;">)</span>
     <span style="color: #7060A8;">printf</span><span style="color: #0000FF;">(</span><span style="color: #000000;">1</span><span style="color: #0000FF;">,</span><span style="color: #008000;">"input1 : %s\n"</span><span style="color: #0000FF;">,</span> <span style="color: #0000FF;">{</span><span style="color: #000000;">input1</span><span style="color: #0000FF;">})</span>
     <span style="color: #7060A8;">printf</span><span style="color: #0000FF;">(</span><span style="color: #000000;">1</span><span style="color: #0000FF;">,</span><span style="color: #008000;">"input2 : %s\n"</span><span style="color: #0000FF;">,</span> <span style="color: #0000FF;">{</span><span style="color: #000000;">input2</span><span style="color: #0000FF;">})</span>
     <span style="color: #004080;">sequence</span> <span style="color: #000000;">s1</span> <span style="color: #0000FF;">:=</span> <span style="color: #000000;">mostFreqKHashing</span><span style="color: #0000FF;">(</span><span style="color: #000000;">input1</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">k</span><span style="color: #0000FF;">),</span>
              <span style="color: #000000;">s2</span> <span style="color: #0000FF;">:=</span> <span style="color: #000000;">mostFreqKHashing</span><span style="color: #0000FF;">(</span><span style="color: #000000;">input2</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">k</span><span style="color: #0000FF;">)</span>
     <span style="color: #7060A8;">printf</span><span style="color: #0000FF;">(</span><span style="color: #000000;">1</span><span style="color: #0000FF;">,</span><span style="color: #008000;">"mfkh(input1, %d) = %s\n"</span><span style="color: #0000FF;">,</span> <span style="color: #0000FF;">{</span><span style="color: #000000;">k</span><span style="color: #0000FF;">,</span><span style="color: #000000;">flat</span><span style="color: #0000FF;">(</span><span style="color: #000000;">s1</span><span style="color: #0000FF;">)})</span>
     <span style="color: #7060A8;">printf</span><span style="color: #0000FF;">(</span><span style="color: #000000;">1</span><span style="color: #0000FF;">,</span><span style="color: #008000;">"mfkh(input2, %d) = %s\n"</span><span style="color: #0000FF;">,</span> <span style="color: #0000FF;">{</span><span style="color: #000000;">k</span><span style="color: #0000FF;">,</span><span style="color: #000000;">flat</span><span style="color: #0000FF;">(</span><span style="color: #000000;">s2</span><span style="color: #0000FF;">)})</span>
     <span style="color: #004080;">integer</span> <span style="color: #000000;">result</span> <span style="color: #0000FF;">:=</span> <span style="color: #000000;">maxDistance</span> <span style="color: #0000FF;">-</span> <span style="color: #000000;">mostFreqKSimilarity</span><span style="color: #0000FF;">(</span><span style="color: #000000;">s1</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">s2</span><span style="color: #0000FF;">)</span>
     <span style="color: #7060A8;">printf</span><span style="color: #0000FF;">(</span><span style="color: #000000;">1</span><span style="color: #0000FF;">,</span><span style="color: #008000;">"SDF(input1, input2, %d, %d) = %d\n\n"</span><span style="color: #0000FF;">,</span> <span style="color: #0000FF;">{</span><span style="color: #000000;">k</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">maxDistance</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">result</span><span style="color: #0000FF;">})</span>
 <span style="color: #008080;">end</span> <span style="color: #008080;">procedure</span>
  
 <span style="color: #008080;">constant</span> <span style="color: #000000;">tests</span> <span style="color: #0000FF;">=</span> <span style="color: #0000FF;">{{</span><span style="color: #008000;">"research"</span><span style="color: #0000FF;">,</span> <span style="color: #008000;">"seeking"</span><span style="color: #0000FF;">},</span>
                   <span style="color: #0000FF;">{</span><span style="color: #008000;">"night"</span><span style="color: #0000FF;">,</span> <span style="color: #008000;">"nacht"</span><span style="color: #0000FF;">},</span>
                   <span style="color: #0000FF;">{</span><span style="color: #008000;">"my"</span><span style="color: #0000FF;">,</span> <span style="color: #008000;">"a"</span><span style="color: #0000FF;">},</span>
                   <span style="color: #0000FF;">{</span><span style="color: #008000;">"research"</span><span style="color: #0000FF;">,</span> <span style="color: #008000;">"research"</span><span style="color: #0000FF;">},</span>
                   <span style="color: #0000FF;">{</span><span style="color: #008000;">"aaaaabbbb"</span><span style="color: #0000FF;">,</span> <span style="color: #008000;">"ababababa"</span><span style="color: #0000FF;">},</span>
                   <span style="color: #0000FF;">{</span><span style="color: #008000;">"significant"</span><span style="color: #0000FF;">,</span> <span style="color: #008000;">"capabilities"</span><span style="color: #0000FF;">}}</span>
 <span style="color: #008080;">for</span> <span style="color: #000000;">i</span><span style="color: #0000FF;">=</span><span style="color: #000000;">1</span> <span style="color: #008080;">to</span> <span style="color: #7060A8;">length</span><span style="color: #0000FF;">(</span><span style="color: #000000;">tests</span><span style="color: #0000FF;">)</span> <span style="color: #008080;">do</span>
     <span style="color: #004080;">string</span> <span style="color: #0000FF;">{</span><span style="color: #000000;">t1</span><span style="color: #0000FF;">,</span><span style="color: #000000;">t2</span><span style="color: #0000FF;">}</span> <span style="color: #0000FF;">=</span> <span style="color: #000000;">tests</span><span style="color: #0000FF;">[</span><span style="color: #000000;">i</span><span style="color: #0000FF;">]</span>
     <span style="color: #000000;">mostFreqKSDF</span><span style="color: #0000FF;">(</span><span style="color: #000000;">t1</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">t2</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">2</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">10</span><span style="color: #0000FF;">)</span>
 <span style="color: #008080;">end</span> <span style="color: #008080;">for</span>
  
 <span style="color: #004080;">string</span> <span style="color: #000000;">s1</span> <span style="color: #0000FF;">:=</span> <span style="color: #008000;">"LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"</span><span style="color: #0000FF;">,</span>
        <span style="color: #000000;">s2</span> <span style="color: #0000FF;">:=</span> <span style="color: #008000;">"EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"</span>
 <span style="color: #000000;">mostFreqKSDF</span><span style="color: #0000FF;">(</span><span style="color: #000000;">s1</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">s2</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">2</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">100</span><span style="color: #0000FF;">)</span>
 <span style="color: #000000;">s1</span> <span style="color: #0000FF;">=</span> <span style="color: #008000;">"abracadabra12121212121abracadabra12121212121"</span>
 <span style="color: #000000;">s2</span> <span style="color: #0000FF;">=</span> <span style="color: #7060A8;">reverse</span><span style="color: #0000FF;">(</span><span style="color: #000000;">s1</span><span style="color: #0000FF;">)</span>
 <span style="color: #000000;">mostFreqKSDF</span><span style="color: #0000FF;">(</span><span style="color: #000000;">s1</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">s2</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">2</span><span style="color: #0000FF;">,</span> <span style="color: #000000;">100</span><span style="color: #0000FF;">)</span>
<!--</syntaxhighlight>-->
Output matches Go and Kotlin.

=={{header|Python}}==
{{works with|Python|2.7+}}
'''unoptimized and limited'''
<syntaxhighlight lang="python">import collections
def MostFreqKHashing(inputString, K):
    occuDict = collections.defaultdict(int)
    for c in inputString:
        occuDict[c] += 1
    occuList = sorted(occuDict.items(), key = lambda x: x[1], reverse = True)
    outputStr = ''.join(c + str(cnt) for c, cnt in occuList[:K])
    return outputStr 

#If number of occurrence of the character is not more than 9
def MostFreqKSimilarity(inputStr1, inputStr2):
    similarity = 0
    for i in range(0, len(inputStr1), 2):
        c = inputStr1[i]
        cnt1 = int(inputStr1[i + 1])
        for j in range(0, len(inputStr2), 2):
            if inputStr2[j] == c:
                cnt2 = int(inputStr2[j + 1])
                similarity += cnt1 + cnt2
                break
    return similarity

def MostFreqKSDF(inputStr1, inputStr2, K, maxDistance):
    return maxDistance - MostFreqKSimilarity(MostFreqKHashing(inputStr1,K), MostFreqKHashing(inputStr2,K))</syntaxhighlight>

'''optimized'''

A version that replaces the intermediate string with OrderedDict to reduce the time complexity of lookup operation:
<syntaxhighlight lang="python">import collections
def MostFreqKHashing(inputString, K):
    occuDict = collections.defaultdict(int)
    for c in inputString:
        occuDict[c] += 1
    occuList = sorted(occuDict.items(), key = lambda x: x[1], reverse = True)
    outputDict = collections.OrderedDict(occuList[:K])
    #Return OrdredDict instead of string for faster lookup.
    return outputDict 

def MostFreqKSimilarity(inputStr1, inputStr2):
    similarity = 0
    for c, cnt1 in inputStr1.items():
        #Reduce the time complexity of lookup operation to about O(1).
        if c in inputStr2: 
            cnt2 = inputStr2[c]
            similarity += cnt1 + cnt2
    return similarity

def MostFreqKSDF(inputStr1, inputStr2, K, maxDistance):
    return maxDistance - MostFreqKSimilarity(MostFreqKHashing(inputStr1,K), MostFreqKHashing(inputStr2,K))</syntaxhighlight>
Test:
<syntaxhighlight lang="python">str1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
str2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"
K = 2
maxDistance = 100
dict1 = MostFreqKHashing(str1, 2)
print("%s:"%dict1)
print(''.join(c + str(cnt) for c, cnt in dict1.items()))
dict2 = MostFreqKHashing(str2, 2)
print("%s:"%dict2)
print(''.join(c + str(cnt) for c, cnt in dict2.items()))
print(MostFreqKSDF(str1, str2, K, maxDistance))</syntaxhighlight>
{{out}}
<pre>
OrderedDict([('L', 9), ('T', 8)]):
L9T8
OrderedDict([('F', 9), ('L', 8)]):
F9L8
83
</pre>

=={{header|Racket}}==

<syntaxhighlight lang="racket">#lang racket

(define (MostFreqKHashing inputString K)
  (define t (make-hash))
  (for ([c (in-string inputString)] [i (in-naturals)])
    (define b (cdr (hash-ref! t c (λ() (cons i (box 0))))))
    (set-box! b (add1 (unbox b))))
  (define l (for/list ([(k v) (in-hash t)]) (list (car v) k (unbox (cdr v)))))
  (map cdr (take (sort (sort l < #:key car) > #:key caddr) K)))

(define (MostFreqKSimilarity inputStr1 inputStr2) ; not strings in this impl.
  (for*/sum ([c1 (in-list inputStr1)] [c2 (in-value (assq (car c1) inputStr2))]
             #:when c2)
    (+ (cadr c1) (cadr c2))))

(define (MostFreqKSDF inputStr1 inputStr2 K maxDistance)
  (- maxDistance (MostFreqKSimilarity (MostFreqKHashing inputStr1 K)
                                      (MostFreqKHashing inputStr2 K))))

(MostFreqKSDF
 "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
 "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"
 2 100)
;; => 83

;; (Should add more tests, but it looks like there's a bunch of mistakes
;; in the given tests...)
</syntaxhighlight>

=={{header|Raku}}==
(formerly Perl 6)
{{works with|Rakudo|2017.09}}
My initial impressions of this task are registered on the discussion page under "Prank Page?".

The "most frequent k characters" hashing function is straightforward enough to implement. The distance function is incomprehensible though. The description doesn't match the pseudo-code and neither of them match the examples. I'm not going to bother trying to figure it out unless there is some possible value.

Maybe I am too hasty though. Lets give it a try. Implement a MFKC routine and run an assortment of words through it to get a feel for how it hashes different words.

<syntaxhighlight lang="raku" line># Fairly straightforward implementation, actually returns a list of pairs
# which can be joined to make a string or manipulated further.

sub mfkh ($string, \K = 2) {
    my %h;
    $string.comb.kv.map: { %h{$^v}[1] //= $^k; %h{$^v}[0]++ };
    %h.sort( { -$_.value[0], $_.value[1] } ).head(K).map( { $_.key => $_.value[0] } );
}

# lets try running 150 or so words from unixdic.txt through it to see
# how many unique hash values it comes up with.

my @test-words = <
    aminobenzoic arginine asinine biennial biennium brigantine brinkmanship
    britannic chinquapin clinging corinthian declination dickinson dimension
    dinnertime dionysian diophantine dominican financial financier finessing
    fingernail fingerprint finnish giovanni hopkinsian inaction inalienable
    inanimate incaution incendiary incentive inception incident incidental
    incinerate incline inclusion incommunicable incompletion inconceivable
    inconclusive incongruity inconsiderable inconsiderate inconspicuous
    incontrovertible inconvertible incurring incursion indefinable indemnify
    indemnity indeterminacy indian indiana indicant indifferent indigene
    indigenous indigent indispensable indochina indochinese indoctrinate
    indonesia inequivalent inexplainable infantile inferential inferring
    infestation inflammation inflationary influential information infringe
    infusion ingenious ingenuity ingestion ingredient inhabitant inhalation
    inharmonious inheritance inholding inhomogeneity inkling inoffensive
    inordinate inorganic inputting inseminate insensible insincere insinuate
    insistent insomnia insomniac insouciant installation instinct instinctual
    insubordinate insubstantial insulin insurrection intangible intelligent
    intensify intensive interception interruption intestinal intestine
    intoxicant introduction introversion intrusion invariant invasion inventive
    inversion involution justinian kidnapping kingpin lineprinter liniment
    livingston mainline mcginnis minion minneapolis minnie pigmentation
    pincushion pinion quinine quintessential resignation ruination seminarian
    triennial wilkinson wilmington wilsonian wineskin winnie winnipeg  
>;

say @test-words.map( { join '', mfkh($_)».kv } ).Bag;</syntaxhighlight>
{{out}}
<pre>Bag(i2n2(151))</pre>
One... Nope, I was right, it ''is'' pretty much worthless.

=={{header|Ring}}==
<syntaxhighlight lang="ring">
# Project : Most frequent k chars distance

load "stdlib.ring"
str1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
str2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"
see "Str1 = " + str1 + nl
see "Str2 = " + str2 + nl

MostFreqKHashing(str1,"str1")
MostFreqKHashing(str2,"str2")

func MostFreqKHashing(str3,strp)
        chr = newlist(26,2)
        for n = 1 to 26
             str = char(n+64)
             cstr = count(str3,str)
             chr[n][1] = str
             chr[n][2] = cstr
        next
        chr = sortsecond(chr)
        chr = reverse(chr)
        see "MostFreqKHashing(" + strp + ",2) = "
        see chr[1][1] + chr[1][2] + chr[2][1] + chr[2][2] + nl

func count(cString,dString)
       sum = 0
       while substr(cString,dString) > 0
               sum++
               cString = substr(cString,substr(cString,dString)+len(string(sum)))
       end
       return sum

func sortsecond(alist)
        aList = sort(alist,2)
        for n=1 to len(alist)-1
             for m=n to len(aList)-1 
                   if alist[m+1][2] = alist[m][2] and alist[m+1][1] < alist[m][1]
                      temp = alist[m+1]
                      alist[m+1] = alist[m]
                      alist[m] = temp ok
             next
       next
       return aList
</syntaxhighlight>
Output:
<pre>
Str1 = LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
Str2 = EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
MostFreqKHashing(str1,2) = L9T8
MostFreqKHashing(str2,2) = F9L8
</pre>

=={{header|Sidef}}==
<syntaxhighlight lang="ruby">func _MostFreqKHashing(string, k) {

    var seen = Hash()
    var chars = string.chars
    var freq = chars.freq
    var schars = freq.keys.sort_by {|c| -freq{c} }

    var mfkh = []
    for i in ^k {
        chars.each { |c|
            seen{c} && next
            if (freq{c} == freq{schars[i]}) {
                seen{c} = true
                mfkh << Hash(c => c, f => freq{c})
                break
            }
        }
    }

    mfkh << (k-seen.len -> of { Hash(c => :NULL, f => 0) }...)
    mfkh
}

func MostFreqKSDF(a, b, k, d) {

    var mfkh_a = _MostFreqKHashing(a, k);
    var mfkh_b = _MostFreqKHashing(b, k);

    d - gather {
        mfkh_a.each { |s|
            s{:c} == :NULL && next
            mfkh_b.each { |t|
                s{:c} == t{:c} &&
                    take(s{:f} + (s{:f} == t{:f} ? 0 : t{:f}))
            }
        }
    }.sum
}

func MostFreqKHashing(string, k) {
    gather {
        _MostFreqKHashing(string, k).each { |h|
            take("%s%d" % (h{:c}, h{:f}))
        }
    }.join
}


var str1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
var str2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"

say "str1 = #{str1.dump}"
say "str2 = #{str2.dump}"

say ''

say("MostFreqKHashing(str1, 2) = ", MostFreqKHashing(str1, 2))
say("MostFreqKHashing(str2, 2) = ", MostFreqKHashing(str2, 2))
say("MostFreqKSDF(str1, str2, 2, 100) = ", MostFreqKSDF(str1, str2, 2, 100))

say ''

var arr = [
    %w(night nacht),
    %w(my a),
    %w(research research),
    %w(aaaaabbbb ababababa),
    %w(significant capabilities),
]

var k = 2
var limit = 10

for s,t in arr {
    "mfkh(%s, %s, #{k}) = [%s, %s] (SDF: %d)\n".printf(
        s.dump, t.dump,
        MostFreqKHashing(s, k).dump,
        MostFreqKHashing(t, k).dump,
        MostFreqKSDF(s, t, k, limit),
    )
}</syntaxhighlight>
{{out}}
<pre>
str1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
str2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"

MostFreqKHashing(str1, 2) = L9T8
MostFreqKHashing(str2, 2) = F9L8
MostFreqKSDF(str1, str2, 2, 100) = 83

mfkh("night", "nacht", 2) = ["n1i1", "n1a1"] (SDF: 9)
mfkh("my", "a", 2) = ["m1y1", "a1NULL0"] (SDF: 10)
mfkh("research", "research", 2) = ["r2e2", "r2e2"] (SDF: 6)
mfkh("aaaaabbbb", "ababababa", 2) = ["a5b4", "a5b4"] (SDF: 1)
mfkh("significant", "capabilities", 2) = ["i3n2", "i3a2"] (SDF: 7)
</pre>

=={{header|Tcl}}==
{{works with|Tcl|8.6}}
<syntaxhighlight lang="tcl">package require Tcl 8.6

proc MostFreqKHashing {inputString k} {
    foreach ch [split $inputString ""] {dict incr count $ch}
    join [lrange [lsort -stride 2 -index 1 -integer -decreasing $count] 0 [expr {$k*2-1}]] ""
}
proc MostFreqKSimilarity {hashStr1 hashStr2} {
    while {$hashStr2 ne ""} {
	regexp {^(.)(\d+)(.*)$} $hashStr2 -> ch n hashStr2
	set lookup($ch) $n
    }
    set similarity 0
    while {$hashStr1 ne ""} {
	regexp {^(.)(\d+)(.*)$} $hashStr1 -> ch n hashStr1
	if {[info exist lookup($ch)]} {
	    incr similarity $n
	    incr similarity $lookup($ch)
	}
    }
    return $similarity
}
proc MostFreqKSDF {inputStr1 inputStr2 k limit} {
    set h1 [MostFreqKHashing $inputStr1 $k]
    set h2 [MostFreqKHashing $inputStr2 $k]
    expr {$limit - [MostFreqKSimilarity $h1 $h2]}
}</syntaxhighlight>
Demonstrating:
<syntaxhighlight lang="tcl">set str1 "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
set str2 "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"
puts [MostFreqKHashing $str1 2]
puts [MostFreqKHashing $str2 2]
puts [MostFreqKSDF $str1 $str2 2 100]</syntaxhighlight>
{{out}}
<pre>
L9T8
F9L8
83
</pre>
;A more efficient metric calculator
This version is appreciably more efficient because it does not compute the intermediate string representation “hash”, instead working directly on the intermediate dictionaries and lists:
<syntaxhighlight lang="tcl">proc MostFreqKSDF {inputStr1 inputStr2 k limit} {
    set c1 [set c2 {}]
    foreach ch [split $inputStr1 ""] {dict incr c1 $ch}
    foreach ch [split $inputStr2 ""] {dict incr c2 $ch}
    set c2 [lrange [lsort -stride 2 -index 1 -integer -decreasing $c2[set c2 {}]] 0 [expr {$k*2-1}]]
    set s 0
    foreach {ch n} [lrange [lsort -stride 2 -index 1 -integer -decreasing $c1[set c1 {}]] 0 [expr {$k*2-1}]] {
	if {[dict exists $c2 $ch]} {
	    incr s [expr {$n + [dict get $c2 $ch]}]
	}
    }
    return [expr {$limit - $s}]
}</syntaxhighlight>
It computes the identical value on the identical inputs.

=={{header|Typescript}}==
{{trans|Javascript}} with added type annotations
<syntaxhighlight lang="typescript">//returns an object of counts keyed by character
const kCounts = (str: string): Record<string, number> => {
  const counts: Record<string, number> = {};
  for (let char of str) {
    counts[char] = counts[char] ? counts[char] + 1 : 1;
  }
  return counts;
};

//returns an array of length k containing the characters with the highest counts
const frequentK = ( counts: Record<string, number>, k: number ): string[] => {
  //note that this is written for clarity rather than speed,
  //as it sorts all of the counts when only the top k are needed
  return Object.keys(counts)
    .sort((a, b) => counts[b] - counts[a])
    .slice(0, k);
};

//returns a hashed string of the most frequent k characters and their frequencies
const mostFreqKHashing = (str: string, k: number): string => {
  const counts = kCounts(str);
  return frequentK(counts, k)
    .map(char => char + counts[char])
    .join("");
};

//numeric score of similarity based on the sum of counts of characters appearing in the top k of both strings
const mostFreqKSimilarity = ( str1: string, str2: string, k: number ): number => {
  const counts1 = kCounts(str1);
  const counts2 = kCounts(str2);
  const freq1 = frequentK(counts1, k);
  const freq2 = frequentK(counts2, k);
  let similarity = 0;
  for (let char of freq1) {
    //only considers a character if it is in the top k of both strings
    if (freq2.includes(char)) {
      //the examples on this page are inconsistent in whether the similarity
      //should be the sum of the two counts or only the shared count (the minimum of the two)
      //this code uses the sum
      similarity += counts1[char] + counts2[char];
    }
  }
  return similarity;
};

//subtracts the similarity score from the maxDifference
const mostFreqKSDF = ( str1: string, str2: string, k: number, maxDistance: number ): number => {
  return maxDistance - mostFreqKSimilarity(str1, str2, k);
};</syntaxhighlight>

=={{header|Wren}}==
{{trans|Kotlin}}
{{libheader|Wren-seq}}
{{libheader|Wren-sort}}
{{libheader|Wren-iterate}}
<syntaxhighlight lang="wren">import "./seq" for Lst
import "./sort" for Sort
import "./iterate" for Stepped

var mostFreqKHashing = Fn.new { |input, k|
   var indivs = Lst.individuals(input.toList).map { |indiv| [indiv[0], indiv[1]] }.toList
   var cmp = Fn.new { |p1, p2| (p2[1] - p1[1]).sign }
   Sort.insertion(indivs, cmp)
   return indivs.take(k).reduce("") { |acc, p| acc + "%(p[0])%(String.fromByte(p[1]))" }
}

var mostFreqKSimilarity = Fn.new { |input1, input2|
    var similarity = 0
    for (i in Stepped.new(0...input1.count, 2)) {
        for (j in Stepped.new(0...input2.count, 2)) {
            if (input1[i] == input2[j]) {
                var freq1 = input1[i + 1].bytes[0]
                var freq2 = input2[j + 1].bytes[0]
                if (freq1 == freq2) similarity = similarity + freq1
            }
        }
    }
    return similarity
}

var mostFreqKSDF = Fn.new { |input1, input2, k, maxDistance|
    System.print("input1 : %(input1)")
    System.print("input2 : %(input2)")
    var s1 = mostFreqKHashing.call(input1, k)
    var s2 = mostFreqKHashing.call(input2, k)
    System.write("mfkh(input1, %(k)) = ")
    var i = 0
    for (c in s1) {
        System.write((i % 2 == 0) ? c : c.bytes[0])
        i = i + 1
    }
    System.write("\nmfkh(input2, %(k)) = ")
    i = 0
    for (c in s2) {
        System.write((i % 2 == 0) ? c : c.bytes[0])
        i = i + 1
    }
    var result = maxDistance - mostFreqKSimilarity.call(s1, s2)
    System.print("\nSDF(input1, input2, %(k), %(maxDistance)) = %(result)\n")
}

var pairs = [
    ["research", "seeking"],
    ["night", "nacht"],
    ["my", "a"],
    ["research", "research"],
    ["aaaaabbbb", "ababababa"],
    ["significant", "capabilities"]
]
for (pair in pairs) mostFreqKSDF.call(pair[0], pair[1], 2, 10)

var s1 = "LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV"
var s2 = "EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG"
mostFreqKSDF.call(s1, s2, 2, 100)
s1 = "abracadabra12121212121abracadabra12121212121"
s2 = s1[-1..0]
mostFreqKSDF.call(s1, s2, 2, 100)</syntaxhighlight>

{{out}}
<pre>
Sane as Kotlin entry.
</pre>

;References
{{reflist}}